<?xml version="1.0"?>
<CCTOPItem id="O25897" transmembrane="yes" evidence="Prediction">
	<Copyright>Copyrighted by the Institute of Enzymology!</Copyright>
	<Name>Biopolymer transport protein ExbB</Name>
	<CrossRef>
		<UniProt id="EXBB_HELPY">
			<AC>O25897</AC>
		</UniProt>
	</CrossRef>
	<Sequence length="145" checkSum="0177c3ed739c0321f09ccf2b1b535128">
		<Seq>MGGFSVGMLKDYVDIFVFAVLGVASFLALWFAIERVIFYSKVDLKAYDDI
DALNLDLTKNLTILYVIFSNAPYVGLLGTVLGIMVIFYDMGVSGGMDAKT
IMVGLSLALKATALGLAVAIPTLIAYNSLLRKSDVLSEKFRIMKK</Seq>
	</Sequence>
	<Topology numTM="3" reliability="86.5943">
		<Region from="1" to="14" loc="O"/>
		<Region from="15" to="33" loc="M"/>
		<Region from="34" to="63" loc="I"/>
		<Region from="64" to="87" loc="M"/>
		<Region from="88" to="106" loc="O"/>
		<Region from="107" to="130" loc="M"/>
		<Region from="131" to="145" loc="I"/>
	</Topology>
	<Predictions>
		<Prediction name="HMMTOP">
			<Region from="1" to="14" loc="O"/>
			<Region from="15" to="33" loc="M"/>
			<Region from="34" to="60" loc="I"/>
			<Region from="61" to="86" loc="M"/>
			<Region from="87" to="102" loc="O"/>
			<Region from="103" to="130" loc="M"/>
			<Region from="131" to="145" loc="I"/>
		</Prediction>
		<Prediction name="Memsat">
			<Region from="1" to="12" loc="O"/>
			<Region from="13" to="37" loc="M"/>
			<Region from="38" to="62" loc="I"/>
			<Region from="63" to="87" loc="M"/>
			<Region from="88" to="99" loc="O"/>
			<Region from="100" to="127" loc="M"/>
			<Region from="128" to="145" loc="I"/>
		</Prediction>
		<Prediction name="Octopus">
			<Region from="1" to="14" loc="O"/>
			<Region from="15" to="35" loc="M"/>
			<Region from="36" to="66" loc="I"/>
			<Region from="67" to="87" loc="M"/>
			<Region from="88" to="105" loc="O"/>
			<Region from="106" to="126" loc="M"/>
			<Region from="127" to="145" loc="I"/>
		</Prediction>
		<Prediction name="Philius">
			<Region from="1" to="11" loc="O"/>
			<Region from="12" to="33" loc="M"/>
			<Region from="34" to="63" loc="I"/>
			<Region from="64" to="88" loc="M"/>
			<Region from="89" to="106" loc="O"/>
			<Region from="107" to="130" loc="M"/>
			<Region from="131" to="145" loc="I"/>
		</Prediction>
		<Prediction name="Phobius">
			<Region from="1" to="11" loc="I"/>
			<Region from="12" to="33" loc="M"/>
			<Region from="34" to="62" loc="O"/>
			<Region from="63" to="88" loc="M"/>
			<Region from="89" to="99" loc="I"/>
			<Region from="100" to="126" loc="M"/>
			<Region from="127" to="145" loc="O"/>
		</Prediction>
		<Prediction name="Pro">
			<Region from="1" to="12" loc="O"/>
			<Region from="13" to="33" loc="M"/>
			<Region from="34" to="63" loc="I"/>
			<Region from="64" to="84" loc="M"/>
			<Region from="85" to="104" loc="O"/>
			<Region from="105" to="125" loc="M"/>
			<Region from="126" to="145" loc="I"/>
		</Prediction>
		<Prediction name="Prodiv">
			<Region from="1" to="11" loc="O"/>
			<Region from="12" to="32" loc="M"/>
			<Region from="33" to="67" loc="I"/>
			<Region from="68" to="88" loc="M"/>
			<Region from="89" to="104" loc="O"/>
			<Region from="105" to="125" loc="M"/>
			<Region from="126" to="145" loc="I"/>
		</Prediction>
		<Prediction name="Scampi">
			<Region from="1" to="12" loc="O"/>
			<Region from="13" to="33" loc="M"/>
			<Region from="34" to="70" loc="I"/>
			<Region from="71" to="91" loc="M"/>
			<Region from="92" to="108" loc="O"/>
			<Region from="109" to="129" loc="M"/>
			<Region from="130" to="145" loc="I"/>
		</Prediction>
		<Prediction name="ScampiMsa">
			<Region from="1" to="13" loc="O"/>
			<Region from="14" to="33" loc="M"/>
			<Region from="34" to="60" loc="I"/>
			<Region from="61" to="80" loc="M"/>
			<Region from="81" to="108" loc="O"/>
			<Region from="109" to="128" loc="M"/>
			<Region from="129" to="145" loc="I"/>
		</Prediction>
		<Prediction name="TMHMM">
			<Region from="1" to="14" loc="O"/>
			<Region from="15" to="37" loc="M"/>
			<Region from="38" to="65" loc="I"/>
			<Region from="66" to="88" loc="M"/>
			<Region from="89" to="107" loc="O"/>
			<Region from="108" to="130" loc="M"/>
			<Region from="131" to="145" loc="I"/>
		</Prediction>
	</Predictions>
</CCTOPItem>
