<?xml version="1.0"?>
<CCTOPItem id="A0A0N4U0J2" transmembrane="yes" evidence="Prediction">
	<Copyright>Copyrighted by the Institute of Enzymology!</Copyright>
	<Sequence length="143" checkSum="018db98ee960f0b31995648b3795a655">
		<Seq>MKASLVNITELQPADVENFRWHFQLKCTNCGEKPDHWQYAIISETMEVPG
GRGLANIVIKCKLCERVNTLRELLECIFTTVIVQRIICRSFSTWLAKSTQ
SNTVFDDIDLTEKVYFTEISYCFILLFSFFISFDLIVFAYRLF</Seq>
	</Sequence>
	<Topology numTM="1" reliability="75.6459">
		<Region from="1" to="118" loc="I"/>
		<Region from="119" to="139" loc="M"/>
		<Region from="140" to="143" loc="O"/>
	</Topology>
	<Predictions>
		<Prediction name="HMMTOP">
			<Region from="1" to="121" loc="O"/>
			<Region from="122" to="140" loc="M"/>
			<Region from="141" to="143" loc="I"/>
		</Prediction>
		<Prediction name="Memsat">
			<Region from="1" to="73" loc="O"/>
			<Region from="74" to="89" loc="M"/>
			<Region from="90" to="115" loc="I"/>
			<Region from="116" to="140" loc="M"/>
			<Region from="141" to="143" loc="O"/>
		</Prediction>
		<Prediction name="Octopus">
			<Region from="1" to="118" loc="I"/>
			<Region from="119" to="139" loc="M"/>
			<Region from="140" to="143" loc="O"/>
		</Prediction>
		<Prediction name="Philius">
			<Region from="1" to="118" loc="I"/>
			<Region from="119" to="140" loc="M"/>
			<Region from="141" to="143" loc="O"/>
		</Prediction>
		<Prediction name="Phobius">
			<Region from="1" to="118" loc="I"/>
			<Region from="119" to="140" loc="M"/>
			<Region from="141" to="143" loc="O"/>
		</Prediction>
		<Prediction name="Pro">
			<Region from="1" to="118" loc="I"/>
			<Region from="119" to="139" loc="M"/>
			<Region from="140" to="143" loc="O"/>
		</Prediction>
		<Prediction name="Prodiv">
			<Region from="1" to="118" loc="I"/>
			<Region from="119" to="139" loc="M"/>
			<Region from="140" to="143" loc="O"/>
		</Prediction>
		<Prediction name="Scampi">
			<Region from="1" to="68" loc="I"/>
			<Region from="69" to="89" loc="M"/>
			<Region from="90" to="118" loc="O"/>
			<Region from="119" to="139" loc="M"/>
			<Region from="140" to="143" loc="I"/>
		</Prediction>
		<Prediction name="ScampiMsa">
			<Region from="1" to="68" loc="I"/>
			<Region from="69" to="88" loc="M"/>
			<Region from="89" to="118" loc="O"/>
			<Region from="119" to="138" loc="M"/>
			<Region from="139" to="143" loc="I"/>
		</Prediction>
		<Prediction name="TMHMM">
			<Region from="1" to="118" loc="I"/>
			<Region from="119" to="141" loc="M"/>
			<Region from="142" to="143" loc="O"/>
		</Prediction>
	</Predictions>
</CCTOPItem>
