<?xml version="1.0"?>
<CCTOPItem id="A0A146MGC6" transmembrane="yes" evidence="Prediction">
	<Copyright>Copyrighted by the Institute of Enzymology!</Copyright>
	<Sequence length="60" checkSum="023c2d64f79e9d727a68169ee397de0a">
		<Seq>MSGGSSVPDSAFTGWKYYFNSYTLKGRFNIVMANYAILFAGIAIWRMRSK
KKKALKKDET</Seq>
	</Sequence>
	<Topology numTM="1" reliability="93.3897">
		<Region from="1" to="27" loc="O"/>
		<Region from="28" to="45" loc="M"/>
		<Region from="46" to="60" loc="I"/>
	</Topology>
	<Predictions>
		<Prediction name="HMMTOP">
			<Region from="1" to="29" loc="O"/>
			<Region from="30" to="45" loc="M"/>
			<Region from="46" to="60" loc="I"/>
		</Prediction>
		<Prediction name="Memsat">
			<Region from="1" to="28" loc="O"/>
			<Region from="29" to="44" loc="M"/>
			<Region from="45" to="60" loc="I"/>
		</Prediction>
		<Prediction name="Octopus">
			<Region from="1" to="26" loc="O"/>
			<Region from="27" to="47" loc="M"/>
			<Region from="48" to="60" loc="I"/>
		</Prediction>
		<Prediction name="Philius">
			<Region from="1" to="26" loc="O"/>
			<Region from="27" to="47" loc="M"/>
			<Region from="48" to="60" loc="I"/>
		</Prediction>
		<Prediction name="Phobius">
			<Region from="1" to="27" loc="O"/>
			<Region from="28" to="47" loc="M"/>
			<Region from="48" to="60" loc="I"/>
		</Prediction>
		<Prediction name="Pro">
			<Region from="1" to="20" loc="O"/>
			<Region from="21" to="41" loc="M"/>
			<Region from="42" to="60" loc="I"/>
		</Prediction>
		<Prediction name="Prodiv">
			<Region from="1" to="20" loc="O"/>
			<Region from="21" to="41" loc="M"/>
			<Region from="42" to="60" loc="I"/>
		</Prediction>
		<Prediction name="Scampi">
			<Region from="1" to="26" loc="O"/>
			<Region from="27" to="47" loc="M"/>
			<Region from="48" to="60" loc="I"/>
		</Prediction>
		<Prediction name="ScampiMsa">
			<Region from="1" to="26" loc="O"/>
			<Region from="27" to="46" loc="M"/>
			<Region from="47" to="60" loc="I"/>
		</Prediction>
		<Prediction name="TMHMM">
			<Region from="1" to="27" loc="O"/>
			<Region from="28" to="45" loc="M"/>
			<Region from="46" to="60" loc="I"/>
		</Prediction>
	</Predictions>
</CCTOPItem>
