<?xml version="1.0"?>
<CCTOPItem id="A0A0K0DS02" transmembrane="yes" evidence="Prediction">
	<Copyright>Copyrighted by the Institute of Enzymology!</Copyright>
	<Sequence length="89" checkSum="068ecfd7b9a23ee0d7116cff2e7fdea4">
		<Seq>MKSKITSEFATSLLKLNKYVFFSYKKELQQYCILLIINEKISRVVCLNQI
RSLFYLLTFIYQNVWVTILNTLSFIFFIIFSILYLFIQF</Seq>
	</Sequence>
	<Topology numTM="1" reliability="67.2517">
		<Region from="1" to="63" loc="I"/>
		<Region from="64" to="87" loc="M"/>
		<Region from="88" to="89" loc="O"/>
	</Topology>
	<Predictions>
		<Prediction name="HMMTOP">
			<Region from="1" to="4" loc="I"/>
			<Region from="5" to="23" loc="L"/>
			<Region from="24" to="40" loc="I"/>
			<Region from="41" to="59" loc="L"/>
			<Region from="60" to="63" loc="I"/>
			<Region from="64" to="87" loc="M"/>
			<Region from="88" to="89" loc="O"/>
		</Prediction>
		<Prediction name="Memsat">
			<Region from="1" to="45" loc="O"/>
			<Region from="46" to="61" loc="M"/>
			<Region from="62" to="64" loc="I"/>
			<Region from="65" to="86" loc="M"/>
			<Region from="87" to="89" loc="O"/>
		</Prediction>
		<Prediction name="Octopus">
			<Region from="1" to="52" loc="I"/>
			<Region from="53" to="59" loc="L"/>
			<Region from="60" to="67" loc="I"/>
			<Region from="68" to="88" loc="M"/>
			<Region from="89" to="89" loc="O"/>
		</Prediction>
		<Prediction name="Philius">
			<Region from="1" to="63" loc="I"/>
			<Region from="64" to="87" loc="M"/>
			<Region from="88" to="89" loc="O"/>
		</Prediction>
		<Prediction name="Phobius">
			<Region from="1" to="63" loc="O"/>
			<Region from="64" to="87" loc="M"/>
			<Region from="88" to="89" loc="I"/>
		</Prediction>
		<Prediction name="Pro">
			<Region from="1" to="64" loc="I"/>
			<Region from="65" to="85" loc="M"/>
			<Region from="86" to="89" loc="O"/>
		</Prediction>
		<Prediction name="Prodiv">
			<Region from="1" to="42" loc="I"/>
			<Region from="43" to="63" loc="M"/>
			<Region from="64" to="67" loc="O"/>
			<Region from="68" to="88" loc="M"/>
			<Region from="89" to="89" loc="I"/>
		</Prediction>
		<Prediction name="Scampi">
			<Region from="1" to="62" loc="I"/>
			<Region from="63" to="83" loc="M"/>
			<Region from="84" to="89" loc="O"/>
		</Prediction>
		<Prediction name="ScampiMsa">
			<Region from="1" to="26" loc="I"/>
			<Region from="27" to="46" loc="M"/>
			<Region from="47" to="66" loc="O"/>
			<Region from="67" to="86" loc="M"/>
			<Region from="87" to="89" loc="I"/>
		</Prediction>
		<Prediction name="TMHMM">
			<Region from="1" to="64" loc="I"/>
			<Region from="65" to="87" loc="M"/>
			<Region from="88" to="89" loc="O"/>
		</Prediction>
	</Predictions>
</CCTOPItem>
