<?xml version="1.0"?>
<CCTOPItem id="P48284" transmembrane="yes" evidence="Exists">
	<Copyright>Copyrighted by the Institute of Enzymology!</Copyright>
	<Name>Carbonic anhydrase 4</Name>
	<CrossRef>
		<UniProt id="CAH4_RAT">
			<AC>P48284</AC>
			<AC>Q4QR97</AC>
		</UniProt>
		<Signal id="SignalP">
			<Results>1-19</Results>
			<Parameters>0.999763</Parameters>
		</Signal>
	</CrossRef>
	<Sequence length="309" checkSum="071c316e8b9a5e7bce0fdd86b13c789a">
		<Signal from="1" to="19"/>
		<Seq>MQLLLALLALAYVAPSTEDSHWCYEIQAKEPNSHCSGPEQWTGDCKKNQQ
SPINIVTSKTKLNPSLTPFTFVGYDQKKKWEVKNNQHSVEMSLGEDIYIF
GGDLPTQYKAIQLHLHWSEESNKGSEHSIDGKHFAMEMHVVHKKMTTGDK
VQDSDSKDKIAVLAFMVEVGNEVNEGFQPLVEALSRLSKPFTNSTVSESC
LQDMLPEKKKLSAYFRYQGSLTTPGCDETVIWTVFEEPIKIHKDQFLEFS
KKLYYDQEQKLNMKDNVRPLQPLGNRQVFRSHASGRLLSLPLPTLLVPTL
TCLVASFLH</Seq>
	</Sequence>
	<Topology numTM="1" reliability="73.4156">
		<Region from="1" to="19" loc="S"/>
		<Region from="20" to="286" loc="O"/>
		<Region from="287" to="308" loc="M"/>
		<Region from="309" to="309" loc="I"/>
	</Topology>
	<Predictions>
		<Prediction name="HMMTOP">
			<Region from="20" to="286" loc="O"/>
			<Region from="287" to="308" loc="M"/>
			<Region from="309" to="309" loc="I"/>
		</Prediction>
		<Prediction name="Memsat">
			<Region from="20" to="288" loc="I"/>
			<Region from="289" to="306" loc="M"/>
			<Region from="307" to="309" loc="O"/>
		</Prediction>
		<Prediction name="Octopus">
			<Region from="20" to="287" loc="I"/>
			<Region from="288" to="308" loc="M"/>
			<Region from="309" to="309" loc="O"/>
		</Prediction>
		<Prediction name="Philius">
			<Region from="20" to="286" loc="O"/>
			<Region from="287" to="308" loc="M"/>
			<Region from="309" to="309" loc="I"/>
		</Prediction>
		<Prediction name="Phobius">
			<Region from="20" to="286" loc="I"/>
			<Region from="287" to="308" loc="M"/>
			<Region from="309" to="309" loc="O"/>
		</Prediction>
		<Prediction name="Pro">
			<Region from="20" to="287" loc="I"/>
			<Region from="288" to="308" loc="M"/>
			<Region from="309" to="309" loc="O"/>
		</Prediction>
		<Prediction name="Prodiv">
			<Region from="20" to="284" loc="I"/>
			<Region from="285" to="305" loc="M"/>
			<Region from="306" to="309" loc="O"/>
		</Prediction>
		<Prediction name="Scampi">
			<Region from="20" to="287" loc="I"/>
			<Region from="288" to="308" loc="M"/>
			<Region from="309" to="309" loc="O"/>
		</Prediction>
		<Prediction name="ScampiMsa">
			<Region from="20" to="287" loc="I"/>
			<Region from="288" to="307" loc="M"/>
			<Region from="308" to="309" loc="O"/>
		</Prediction>
	</Predictions>
	<Constraints>
		<Constraint source="SIGNAL" sourceId="SignalP">
			<ConstraintRegion from="20" to="20" loc="O"/>
		</Constraint>
	</Constraints>
</CCTOPItem>
