<?xml version="1.0"?>
<CCTOPItem id="A0A077YV30" transmembrane="yes" evidence="Prediction">
	<Copyright>Copyrighted by the Institute of Enzymology!</Copyright>
	<Sequence length="353" checkSum="090018e4d53c8fea0b4415138fa16f13">
		<Seq>MIDHSYIFIVGGISAASFMVLAVYFYLDTKRNYIYDVPGLHNMGATCFVN
ALLQGLASCKCFVGWTYRFMFYRHCIFLQSLAEILQKLNESTGETLSAAR
VVNALRRRGWILESYSQQDVHELLNVFCSTWSEELTVLKNAKASMQAIVS
IFQRNISPQHSNFQLNNLSQVNNENSNELTASEFPISPCEGLINVQNECL
TCGNKMVTLEECLESFLEREMVDDVACEFCSQDSNSTETRTSRSRTLWLD
TIPLELYLLKGDSSSTNDVTGKQLYRLQAVIVHQGSVSSGHFVTYRRGII
DERYWVSLSDATVSPIGFEKVSLCQAYMVFYERDVDAFSTENSDSGPPAN
SFA</Seq>
	</Sequence>
	<Topology numTM="1" reliability="58.5195">
		<Region from="1" to="6" loc="O"/>
		<Region from="7" to="27" loc="M"/>
		<Region from="28" to="353" loc="I"/>
	</Topology>
	<Predictions>
		<Prediction name="HMMTOP">
			<Region from="1" to="6" loc="O"/>
			<Region from="7" to="27" loc="M"/>
			<Region from="28" to="34" loc="I"/>
			<Region from="35" to="53" loc="M"/>
			<Region from="54" to="353" loc="O"/>
		</Prediction>
		<Prediction name="Memsat">
			<Region from="1" to="13" loc="O"/>
			<Region from="14" to="29" loc="M"/>
			<Region from="30" to="44" loc="I"/>
			<Region from="45" to="60" loc="M"/>
			<Region from="61" to="353" loc="O"/>
		</Prediction>
		<Prediction name="Octopus">
			<Region from="1" to="4" loc="O"/>
			<Region from="5" to="25" loc="M"/>
			<Region from="26" to="353" loc="I"/>
		</Prediction>
		<Prediction name="Philius">
			<Region from="1" to="5" loc="I"/>
			<Region from="6" to="27" loc="M"/>
			<Region from="28" to="43" loc="O"/>
			<Region from="44" to="64" loc="M"/>
			<Region from="65" to="353" loc="I"/>
		</Prediction>
		<Prediction name="Phobius">
			<Region from="1" to="5" loc="O"/>
			<Region from="6" to="27" loc="M"/>
			<Region from="28" to="353" loc="I"/>
		</Prediction>
		<Prediction name="Pro">
			<Region from="1" to="4" loc="O"/>
			<Region from="5" to="25" loc="M"/>
			<Region from="26" to="353" loc="I"/>
		</Prediction>
		<Prediction name="Prodiv">
			<Region from="1" to="4" loc="O"/>
			<Region from="5" to="25" loc="M"/>
			<Region from="26" to="36" loc="I"/>
			<Region from="37" to="57" loc="M"/>
			<Region from="58" to="353" loc="O"/>
		</Prediction>
		<Prediction name="Scampi">
			<Region from="1" to="6" loc="I"/>
			<Region from="7" to="27" loc="M"/>
			<Region from="28" to="50" loc="O"/>
			<Region from="51" to="71" loc="M"/>
			<Region from="72" to="353" loc="I"/>
		</Prediction>
		<Prediction name="ScampiMsa">
			<Region from="1" to="6" loc="O"/>
			<Region from="7" to="26" loc="M"/>
			<Region from="27" to="353" loc="I"/>
		</Prediction>
		<Prediction name="TMHMM">
			<Region from="1" to="4" loc="O"/>
			<Region from="5" to="27" loc="M"/>
			<Region from="28" to="46" loc="I"/>
			<Region from="47" to="69" loc="M"/>
			<Region from="70" to="353" loc="O"/>
		</Prediction>
	</Predictions>
</CCTOPItem>
