<?xml version="1.0"?>
<CCTOPItem id="P58821" transmembrane="yes" evidence="Exists">
	<Copyright>Copyrighted by the Institute of Enzymology!</Copyright>
	<Name>Neuron-specific vesicular protein calcyon</Name>
	<CrossRef>
		<UniProt id="CALY_RAT">
			<AC>P58821</AC>
		</UniProt>
	</CrossRef>
	<Sequence length="226" checkSum="0d81d835a6c09f317c0e7a243290023f">
		<Seq>MVKLGCSFSGKPGKETGDQDGAAMDSVPLISPLDVSQLQPSFPDQVVIKT
QTEYQLTSADQPKKFADLEGQRLACSHPEEGRRLPTARMIAFAMALLGCV
LIMYKAIWYDQFTCPDGFLLRHKICTPLTLEMYYTEMDPERHRSILAAIG
AYPLSRKHGTEMPAIWGNSYRAGKEEHKGTTPAAMTVSTAAAAAAAEGNE
PSGKPLDMREKEDPQKAEDVPSQSPK</Seq>
	</Sequence>
	<Topology numTM="1" reliability="95.2885">
		<Region from="1" to="88" loc="I"/>
		<Region from="89" to="107" loc="M"/>
		<Region from="108" to="226" loc="O"/>
	</Topology>
	<Predictions>
		<Prediction name="HMMTOP">
			<Region from="1" to="88" loc="I"/>
			<Region from="89" to="104" loc="M"/>
			<Region from="105" to="182" loc="O"/>
			<Region from="183" to="198" loc="M"/>
			<Region from="199" to="226" loc="I"/>
		</Prediction>
		<Prediction name="Memsat">
			<Region from="1" to="86" loc="I"/>
			<Region from="87" to="107" loc="M"/>
			<Region from="108" to="226" loc="O"/>
		</Prediction>
		<Prediction name="Octopus">
			<Region from="1" to="85" loc="I"/>
			<Region from="86" to="106" loc="M"/>
			<Region from="107" to="226" loc="O"/>
		</Prediction>
		<Prediction name="Philius">
			<Region from="1" to="88" loc="I"/>
			<Region from="89" to="108" loc="M"/>
			<Region from="109" to="226" loc="O"/>
		</Prediction>
		<Prediction name="Phobius">
			<Region from="1" to="88" loc="I"/>
			<Region from="89" to="109" loc="M"/>
			<Region from="110" to="226" loc="O"/>
		</Prediction>
		<Prediction name="Pro">
			<Region from="1" to="88" loc="I"/>
			<Region from="89" to="109" loc="M"/>
			<Region from="110" to="226" loc="O"/>
		</Prediction>
		<Prediction name="Prodiv">
			<Region from="1" to="88" loc="I"/>
			<Region from="89" to="109" loc="M"/>
			<Region from="110" to="226" loc="O"/>
		</Prediction>
		<Prediction name="Scampi">
			<Region from="1" to="88" loc="I"/>
			<Region from="89" to="109" loc="M"/>
			<Region from="110" to="226" loc="O"/>
		</Prediction>
		<Prediction name="ScampiMsa">
			<Region from="1" to="83" loc="I"/>
			<Region from="84" to="103" loc="M"/>
			<Region from="104" to="226" loc="O"/>
		</Prediction>
		<Prediction name="TMHMM">
			<Region from="1" to="89" loc="I"/>
			<Region from="90" to="112" loc="M"/>
			<Region from="113" to="226" loc="O"/>
		</Prediction>
	</Predictions>
</CCTOPItem>
