<?xml version="1.0"?>
<CCTOPItem id="E3QNZ1" transmembrane="yes" evidence="TOPDOM">
	<Copyright>Copyrighted by the Institute of Enzymology!</Copyright>
	<Name>High osmolarity signaling protein SHO1</Name>
	<CrossRef>
		<UniProt id="SHO1_COLGM">
			<AC>E3QNZ1</AC>
		</UniProt>
		<TOPDOM id="PS50002"/>
	</CrossRef>
	<Sequence length="293" checkSum="10cb63c894d65397758c9424d259aab7">
		<Seq>MEQSRAQYGRKGINMGNIIGDPFALATVSISMLAWIIAFISSIIATTQVT
NDSGSFPPFAWWTVVYMSFVIAGVFVVVASDTAQTYHVALTGYLGAALAL
NSLTIHSLIYSANGARQAAGAGFILMAMVTIVWIFYFGSAPSAKPRAYLD
SFALQKESHSRQMMYGGGRPETSTSVQPPQMYTSAQLNGFENPSPVQGIS
TTQARNSVVAPTFNATPPATKGPGQDQEVVPPTEYPYRAKAIYSYEANPD
DANEISFSKHEILEVSDVSGRWWQARKETGETGIAPSNYLILL</Seq>
	</Sequence>
	<Topology numTM="4" reliability="89.5556">
		<Region from="1" to="21" loc="I"/>
		<Region from="22" to="42" loc="M"/>
		<Region from="43" to="58" loc="O"/>
		<Region from="59" to="79" loc="M"/>
		<Region from="80" to="87" loc="I"/>
		<Region from="88" to="109" loc="M"/>
		<Region from="110" to="117" loc="O"/>
		<Region from="118" to="138" loc="M"/>
		<Region from="139" to="293" loc="I"/>
	</Topology>
	<Predictions>
		<Prediction name="HMMTOP">
			<Region from="1" to="14" loc="I"/>
			<Region from="15" to="42" loc="M"/>
			<Region from="43" to="58" loc="O"/>
			<Region from="59" to="80" loc="M"/>
			<Region from="81" to="87" loc="I"/>
			<Region from="88" to="109" loc="M"/>
			<Region from="110" to="116" loc="O"/>
			<Region from="117" to="138" loc="M"/>
			<Region from="139" to="293" loc="I"/>
		</Prediction>
		<Prediction name="Memsat">
			<Region from="1" to="20" loc="I"/>
			<Region from="21" to="43" loc="M"/>
			<Region from="44" to="60" loc="O"/>
			<Region from="61" to="81" loc="M"/>
			<Region from="82" to="86" loc="I"/>
			<Region from="87" to="103" loc="M"/>
			<Region from="104" to="118" loc="O"/>
			<Region from="119" to="136" loc="M"/>
			<Region from="137" to="293" loc="I"/>
		</Prediction>
		<Prediction name="Octopus">
			<Region from="1" to="23" loc="O"/>
			<Region from="24" to="44" loc="M"/>
			<Region from="45" to="59" loc="I"/>
			<Region from="60" to="80" loc="M"/>
			<Region from="81" to="86" loc="O"/>
			<Region from="87" to="107" loc="M"/>
			<Region from="108" to="115" loc="I"/>
			<Region from="116" to="136" loc="M"/>
			<Region from="137" to="293" loc="O"/>
		</Prediction>
		<Prediction name="Philius">
			<Region from="1" to="18" loc="I"/>
			<Region from="19" to="41" loc="M"/>
			<Region from="42" to="58" loc="O"/>
			<Region from="59" to="79" loc="M"/>
			<Region from="80" to="88" loc="I"/>
			<Region from="89" to="110" loc="M"/>
			<Region from="111" to="117" loc="O"/>
			<Region from="118" to="137" loc="M"/>
			<Region from="138" to="293" loc="I"/>
		</Prediction>
		<Prediction name="Phobius">
			<Region from="1" to="20" loc="I"/>
			<Region from="21" to="47" loc="M"/>
			<Region from="48" to="58" loc="O"/>
			<Region from="59" to="78" loc="M"/>
			<Region from="79" to="89" loc="I"/>
			<Region from="90" to="112" loc="M"/>
			<Region from="113" to="117" loc="O"/>
			<Region from="118" to="138" loc="M"/>
			<Region from="139" to="293" loc="I"/>
		</Prediction>
		<Prediction name="Pro">
			<Region from="1" to="20" loc="I"/>
			<Region from="21" to="41" loc="M"/>
			<Region from="42" to="61" loc="O"/>
			<Region from="62" to="82" loc="M"/>
			<Region from="83" to="84" loc="I"/>
			<Region from="85" to="105" loc="M"/>
			<Region from="106" to="117" loc="O"/>
			<Region from="118" to="138" loc="M"/>
			<Region from="139" to="293" loc="I"/>
		</Prediction>
		<Prediction name="Prodiv">
			<Region from="1" to="20" loc="I"/>
			<Region from="21" to="41" loc="M"/>
			<Region from="42" to="58" loc="O"/>
			<Region from="59" to="79" loc="M"/>
			<Region from="80" to="88" loc="I"/>
			<Region from="89" to="109" loc="M"/>
			<Region from="110" to="117" loc="O"/>
			<Region from="118" to="138" loc="M"/>
			<Region from="139" to="293" loc="I"/>
		</Prediction>
		<Prediction name="Scampi">
			<Region from="1" to="20" loc="I"/>
			<Region from="21" to="41" loc="M"/>
			<Region from="42" to="58" loc="O"/>
			<Region from="59" to="79" loc="M"/>
			<Region from="80" to="89" loc="I"/>
			<Region from="90" to="110" loc="M"/>
			<Region from="111" to="117" loc="O"/>
			<Region from="118" to="138" loc="M"/>
			<Region from="139" to="293" loc="I"/>
		</Prediction>
		<Prediction name="ScampiMsa">
			<Region from="1" to="18" loc="I"/>
			<Region from="19" to="38" loc="M"/>
			<Region from="39" to="58" loc="O"/>
			<Region from="59" to="78" loc="M"/>
			<Region from="79" to="84" loc="I"/>
			<Region from="85" to="104" loc="M"/>
			<Region from="105" to="117" loc="O"/>
			<Region from="118" to="137" loc="M"/>
			<Region from="138" to="293" loc="I"/>
		</Prediction>
		<Prediction name="TMHMM">
			<Region from="1" to="22" loc="I"/>
			<Region from="23" to="45" loc="M"/>
			<Region from="46" to="59" loc="O"/>
			<Region from="60" to="79" loc="M"/>
			<Region from="80" to="85" loc="I"/>
			<Region from="86" to="108" loc="M"/>
			<Region from="109" to="117" loc="O"/>
			<Region from="118" to="140" loc="M"/>
			<Region from="141" to="293" loc="I"/>
		</Prediction>
	</Predictions>
	<Constraints>
		<Constraint source="TOPDOM" sourceId="PS50002">
			<ConstraintRegion from="234" to="293" loc="I"/>
		</Constraint>
	</Constraints>
</CCTOPItem>
