<?xml version="1.0"?>
<CCTOPItem id="A0A077YUJ8" transmembrane="yes" evidence="Prediction">
	<Copyright>Copyrighted by the Institute of Enzymology!</Copyright>
	<Sequence length="170" checkSum="1f40e15426fb086320634910c0981133">
		<Seq>MGMTNCQRKNGIWKDVLELQLPLWTWTVSSVAMYIFQSRSRVRHAFIGAT
LLCFIGLLSCVLVLLLILDHLRRLPGWLAAFGQTVKSSNQVPIVVVPNKI
LSAPAFGRRKYNNDLSRGSMSRKFTNGVSAAHPRRSSSSSNLSTSHGRSS
SFLWRQRLPSQHHFLGHIGR</Seq>
	</Sequence>
	<Topology numTM="2" reliability="73.423">
		<Region from="1" to="20" loc="I"/>
		<Region from="21" to="36" loc="M"/>
		<Region from="37" to="45" loc="O"/>
		<Region from="46" to="68" loc="M"/>
		<Region from="69" to="170" loc="I"/>
	</Topology>
	<Predictions>
		<Prediction name="HMMTOP">
			<Region from="1" to="14" loc="I"/>
			<Region from="15" to="36" loc="M"/>
			<Region from="37" to="46" loc="O"/>
			<Region from="47" to="68" loc="M"/>
			<Region from="69" to="170" loc="I"/>
		</Prediction>
		<Prediction name="Memsat">
			<Region from="1" to="44" loc="I"/>
			<Region from="45" to="71" loc="M"/>
			<Region from="72" to="170" loc="O"/>
		</Prediction>
		<Prediction name="Octopus">
			<Region from="1" to="46" loc="I"/>
			<Region from="47" to="67" loc="M"/>
			<Region from="68" to="170" loc="O"/>
		</Prediction>
		<Prediction name="Philius">
			<Region from="1" to="18" loc="I"/>
			<Region from="19" to="37" loc="M"/>
			<Region from="38" to="44" loc="O"/>
			<Region from="45" to="68" loc="M"/>
			<Region from="69" to="170" loc="I"/>
		</Prediction>
		<Prediction name="Phobius">
			<Region from="1" to="20" loc="I"/>
			<Region from="21" to="39" loc="M"/>
			<Region from="40" to="44" loc="O"/>
			<Region from="45" to="68" loc="M"/>
			<Region from="69" to="170" loc="I"/>
		</Prediction>
		<Prediction name="Pro">
			<Region from="1" to="20" loc="I"/>
			<Region from="21" to="41" loc="M"/>
			<Region from="42" to="45" loc="O"/>
			<Region from="46" to="66" loc="M"/>
			<Region from="67" to="170" loc="I"/>
		</Prediction>
		<Prediction name="Prodiv">
			<Region from="1" to="15" loc="I"/>
			<Region from="16" to="37" loc="M"/>
			<Region from="38" to="45" loc="O"/>
			<Region from="46" to="67" loc="M"/>
			<Region from="68" to="170" loc="I"/>
		</Prediction>
		<Prediction name="Scampi">
			<Region from="1" to="18" loc="I"/>
			<Region from="19" to="39" loc="M"/>
			<Region from="40" to="48" loc="O"/>
			<Region from="49" to="69" loc="M"/>
			<Region from="70" to="170" loc="I"/>
		</Prediction>
		<Prediction name="ScampiMsa">
			<Region from="1" to="18" loc="I"/>
			<Region from="19" to="38" loc="M"/>
			<Region from="39" to="48" loc="O"/>
			<Region from="49" to="68" loc="M"/>
			<Region from="69" to="170" loc="I"/>
		</Prediction>
		<Prediction name="TMHMM">
			<Region from="1" to="45" loc="I"/>
			<Region from="46" to="68" loc="M"/>
			<Region from="69" to="170" loc="O"/>
		</Prediction>
	</Predictions>
</CCTOPItem>
