<?xml version="1.0"?>
<CCTOPItem id="Q5E9H7" transmembrane="yes" evidence="Prediction">
	<Copyright>Copyrighted by the Institute of Enzymology!</Copyright>
	<Name>Very-long-chain 3-oxoacyl-CoA reductase {ECO:0000305}</Name>
	<CrossRef>
		<UniProt id="DHB12_BOVIN">
			<AC>Q5E9H7</AC>
		</UniProt>
	</CrossRef>
	<Sequence length="312" checkSum="237229afb327cb91e7e4477240b5b8eb">
		<Seq>METALPAAGFLYWVGASTVAYLALRISCWFFTALRVWGLGHEAGVGPWLG
EWAVVTGGTDGIGKSYAEELAKRGMKIVLISRSQDKLDQVSSEISEKFKV
ETKTIAVDFTSEDIYDKIKASLAGLNIGVLVNNVGMSYEYPEYFLDVPDL
DNTIKKLITVNALSVCKMTRLVLPGMVERSKGAILNISSASGMYPVPLLT
IYSATKAFVDFFSQCLHEEYKSKGVIVQSVLPYYVATKLAKIKRPTWDKP
SPETFVKSAMKTIGVQSRTNGYPIHSLVASVSASLPSWLYFKIAMYSGNS
IRVRYLKKMKMN</Seq>
	</Sequence>
	<Topology numTM="1" reliability="57.1264">
		<Region from="1" to="6" loc="I"/>
		<Region from="7" to="31" loc="M"/>
		<Region from="32" to="312" loc="O"/>
	</Topology>
	<Predictions>
		<Prediction name="HMMTOP">
			<Region from="1" to="3" loc="O"/>
			<Region from="4" to="31" loc="M"/>
			<Region from="32" to="33" loc="I"/>
			<Region from="34" to="55" loc="M"/>
			<Region from="56" to="275" loc="O"/>
			<Region from="276" to="297" loc="M"/>
			<Region from="298" to="312" loc="I"/>
		</Prediction>
		<Prediction name="Memsat">
			<Region from="1" to="275" loc="O"/>
			<Region from="276" to="292" loc="M"/>
			<Region from="293" to="312" loc="I"/>
		</Prediction>
		<Prediction name="Octopus">
			<Region from="1" to="10" loc="O"/>
			<Region from="11" to="31" loc="M"/>
			<Region from="32" to="49" loc="I"/>
			<Region from="50" to="70" loc="M"/>
			<Region from="71" to="312" loc="O"/>
		</Prediction>
		<Prediction name="Philius">
			<Region from="1" to="8" loc="O"/>
			<Region from="9" to="33" loc="M"/>
			<Region from="34" to="182" loc="I"/>
			<Region from="183" to="202" loc="M"/>
			<Region from="203" to="273" loc="O"/>
			<Region from="274" to="294" loc="M"/>
			<Region from="295" to="312" loc="I"/>
		</Prediction>
		<Prediction name="Phobius">
			<Region from="1" to="11" loc="O"/>
			<Region from="12" to="31" loc="M"/>
			<Region from="32" to="312" loc="I"/>
		</Prediction>
		<Prediction name="Pro">
			<Region from="1" to="9" loc="I"/>
			<Region from="10" to="30" loc="M"/>
			<Region from="31" to="312" loc="O"/>
		</Prediction>
		<Prediction name="Prodiv">
			<Region from="1" to="6" loc="I"/>
			<Region from="7" to="27" loc="M"/>
			<Region from="28" to="42" loc="O"/>
			<Region from="43" to="63" loc="M"/>
			<Region from="64" to="181" loc="I"/>
			<Region from="182" to="202" loc="M"/>
			<Region from="203" to="312" loc="O"/>
		</Prediction>
		<Prediction name="Scampi">
			<Region from="1" to="18" loc="I"/>
			<Region from="19" to="39" loc="M"/>
			<Region from="40" to="312" loc="O"/>
		</Prediction>
		<Prediction name="ScampiMsa">
			<Region from="1" to="10" loc="O"/>
			<Region from="11" to="30" loc="M"/>
			<Region from="31" to="312" loc="I"/>
		</Prediction>
		<Prediction name="TMHMM">
			<Region from="1" to="6" loc="I"/>
			<Region from="7" to="29" loc="M"/>
			<Region from="30" to="312" loc="O"/>
		</Prediction>
	</Predictions>
</CCTOPItem>
