<?xml version="1.0"?>
<CCTOPItem id="Q3ZCG2" transmembrane="yes" evidence="Exists">
	<Copyright>Copyrighted by the Institute of Enzymology!</Copyright>
	<Name>Mitochondrial pyruvate carrier 1</Name>
	<CrossRef>
		<UniProt id="MPC1_BOVIN">
			<AC>Q3ZCG2</AC>
		</UniProt>
	</CrossRef>
	<Sequence length="109" checkSum="259051f6d1115e5e2a5222cedb3ea7af">
		<Seq>MAGALVRKAADYVRSKDFRDYLMSTHFWGPVANWGLPIAAINDMKKSPEI
ISGRMTFALCCYSLTFMRFAYKVQPRNWLLFACHATNEVAQLIQGGRLIR
HEMSKKASA</Seq>
	</Sequence>
	<Topology numTM="2" reliability="72.3366">
		<Region from="1" to="20" loc="I"/>
		<Region from="21" to="41" loc="M"/>
		<Region from="42" to="50" loc="O"/>
		<Region from="51" to="71" loc="M"/>
		<Region from="72" to="109" loc="I"/>
	</Topology>
	<Predictions>
		<Prediction name="HMMTOP">
			<Region from="1" to="26" loc="I"/>
			<Region from="27" to="42" loc="M"/>
			<Region from="43" to="49" loc="O"/>
			<Region from="50" to="66" loc="M"/>
			<Region from="67" to="109" loc="I"/>
		</Prediction>
		<Prediction name="Memsat">
			<Region from="1" to="23" loc="O"/>
			<Region from="24" to="39" loc="M"/>
			<Region from="40" to="55" loc="I"/>
			<Region from="56" to="71" loc="M"/>
			<Region from="72" to="109" loc="O"/>
		</Prediction>
		<Prediction name="Octopus">
			<Region from="1" to="53" loc="I"/>
			<Region from="54" to="74" loc="M"/>
			<Region from="75" to="109" loc="O"/>
		</Prediction>
		<Prediction name="Philius">
			<Region from="1" to="20" loc="I"/>
			<Region from="21" to="41" loc="M"/>
			<Region from="42" to="49" loc="O"/>
			<Region from="50" to="71" loc="M"/>
			<Region from="72" to="109" loc="I"/>
		</Prediction>
		<Prediction name="Phobius">
			<Region from="1" to="20" loc="I"/>
			<Region from="21" to="41" loc="M"/>
			<Region from="42" to="52" loc="O"/>
			<Region from="53" to="71" loc="M"/>
			<Region from="72" to="109" loc="I"/>
		</Prediction>
		<Prediction name="Pro">
			<Region from="1" to="20" loc="I"/>
			<Region from="21" to="41" loc="M"/>
			<Region from="42" to="50" loc="O"/>
			<Region from="51" to="71" loc="M"/>
			<Region from="72" to="109" loc="I"/>
		</Prediction>
		<Prediction name="Prodiv">
			<Region from="1" to="20" loc="I"/>
			<Region from="21" to="41" loc="M"/>
			<Region from="42" to="50" loc="O"/>
			<Region from="51" to="71" loc="M"/>
			<Region from="72" to="109" loc="I"/>
		</Prediction>
		<Prediction name="Scampi">
			<Region from="1" to="50" loc="I"/>
			<Region from="51" to="71" loc="M"/>
			<Region from="72" to="109" loc="O"/>
		</Prediction>
		<Prediction name="ScampiMsa">
			<Region from="1" to="52" loc="I"/>
			<Region from="53" to="72" loc="M"/>
			<Region from="73" to="109" loc="O"/>
		</Prediction>
	</Predictions>
</CCTOPItem>
