<?xml version="1.0"?>
<CCTOPItem id="A0A183XBT2" transmembrane="yes" evidence="Experiment">
	<Copyright>Copyrighted by the Institute of Enzymology!</Copyright>
	<CrossRef>
		<TOPDB id="AP00166">
			<Alignment>
				<CrossRefSeq>-----------LSSLPTQMDYKGQKLAEQMFQGIILFSAIVGFIYGYVAEQFGWTVYIVMAGFAFSCLLTLPPWPIYRRHPLKWLPVQESSTDDKKPGERKIKR---</CrossRefSeq>
				<OrigSeq>MDGLIQMLPPSLRKFSTYIDFVGQRRAERIFQVILVLTAVIGYGIGYVTEQLSYAIYTLCCGFIMSFILVVPPWPYLRRNPVHWQPVQAVTPSSANASSKEKKKKTK</OrigSeq>
			</Alignment>
		</TOPDB>
	</CrossRef>
	<Sequence length="106" checkSum="2b3405a1c7394e3f02be6192656fb029">
		<Seq>MDGLIQMLPPSLRKFSTYIDFVGQRRAERIFQVILVLTAVIGYGIGYVTE
QLSYAIYTLCCGFIMSFILVVPPWPYLRRNPVHWQPVQAVTPSSANASSK
EKKKTK</Seq>
	</Sequence>
	<Topology numTM="2" reliability="85.1809">
		<Region from="1" to="29" loc="I"/>
		<Region from="30" to="49" loc="M"/>
		<Region from="50" to="53" loc="O"/>
		<Region from="54" to="71" loc="M"/>
		<Region from="72" to="106" loc="I"/>
	</Topology>
	<Predictions>
		<Prediction name="HMMTOP">
			<Region from="1" to="32" loc="I"/>
			<Region from="33" to="49" loc="M"/>
			<Region from="50" to="54" loc="O"/>
			<Region from="55" to="71" loc="M"/>
			<Region from="72" to="106" loc="I"/>
		</Prediction>
		<Prediction name="Memsat">
			<Region from="1" to="29" loc="O"/>
			<Region from="30" to="49" loc="M"/>
			<Region from="50" to="52" loc="I"/>
			<Region from="53" to="71" loc="M"/>
			<Region from="72" to="106" loc="O"/>
		</Prediction>
		<Prediction name="Octopus">
			<Region from="1" to="29" loc="I"/>
			<Region from="30" to="50" loc="M"/>
			<Region from="51" to="54" loc="O"/>
			<Region from="55" to="75" loc="M"/>
			<Region from="76" to="106" loc="I"/>
		</Prediction>
		<Prediction name="Philius">
			<Region from="1" to="29" loc="I"/>
			<Region from="30" to="47" loc="M"/>
			<Region from="48" to="53" loc="O"/>
			<Region from="54" to="76" loc="M"/>
			<Region from="77" to="106" loc="I"/>
		</Prediction>
		<Prediction name="Phobius">
			<Region from="1" to="29" loc="I"/>
			<Region from="30" to="48" loc="M"/>
			<Region from="49" to="53" loc="O"/>
			<Region from="54" to="71" loc="M"/>
			<Region from="72" to="106" loc="I"/>
		</Prediction>
		<Prediction name="Pro">
			<Region from="1" to="28" loc="I"/>
			<Region from="29" to="49" loc="M"/>
			<Region from="50" to="53" loc="O"/>
			<Region from="54" to="74" loc="M"/>
			<Region from="75" to="106" loc="I"/>
		</Prediction>
		<Prediction name="Prodiv">
			<Region from="1" to="28" loc="I"/>
			<Region from="29" to="49" loc="M"/>
			<Region from="50" to="53" loc="O"/>
			<Region from="54" to="76" loc="M"/>
			<Region from="77" to="106" loc="I"/>
		</Prediction>
		<Prediction name="Scampi">
			<Region from="1" to="28" loc="I"/>
			<Region from="29" to="49" loc="M"/>
			<Region from="50" to="51" loc="O"/>
			<Region from="52" to="72" loc="M"/>
			<Region from="73" to="106" loc="I"/>
		</Prediction>
		<Prediction name="ScampiMsa">
			<Region from="1" to="29" loc="I"/>
			<Region from="30" to="49" loc="M"/>
			<Region from="50" to="51" loc="O"/>
			<Region from="52" to="71" loc="M"/>
			<Region from="72" to="106" loc="I"/>
		</Prediction>
		<Prediction name="TMHMM">
			<Region from="1" to="29" loc="O"/>
			<Region from="30" to="47" loc="M"/>
			<Region from="48" to="53" loc="I"/>
			<Region from="54" to="76" loc="M"/>
			<Region from="77" to="106" loc="O"/>
		</Prediction>
	</Predictions>
	<Constraints>
		<Constraint source="TOPDB" sourceId="AP00166">
			<ConstraintRegion from="12" to="23" loc="I" subId="00000" subSource="8632014"/>
		</Constraint>
	</Constraints>
</CCTOPItem>
