<?xml version="1.0"?>
<CCTOPItem id="Q8IM16" transmembrane="yes" evidence="Exists">
	<Copyright>Copyrighted by the Institute of Enzymology!</Copyright>
	<Name>Plasmepsin IV {ECO:0000303|PubMed:23471987}</Name>
	<CrossRef>
		<UniProt id="PLM4_PLAF7">
			<AC>Q8IM16</AC>
		</UniProt>
	</CrossRef>
	<Sequence length="449" checkSum="2ea37bc12aab46584e85767afbfca60a">
		<Seq>MALTVKEEEFSNTLIKNASAFDRLKLGNLKNLKIQKKLQFLYLILFVLIT
GVFFFFLIGNFYSHRKLYQVIKNTKHTTIGFKIDRPHDKVLSSVLKNKLS
TYVKESFKFFKSGYAQKGYLGSENDSIELDDVANLMFYGEGQIGTNKQPF
MFIFDTGSANLWVPSVNCDSIGCSTKHLYDASASKSYEKDGTKVEISYGS
GTVRGYFSKDVISLGDLSLPYKFIEVTDADDLEPIYSGSEFDGILGLGWK
DLSIGSIDPVVVELKKQNKIDNALFTFYLPVHDKHVGYLTIGGIESDFYE
GPLTYEKLNHDLYWQIDLDIHFGKYVMQKANAVVDSGTSTITAPTSFLNK
FFRDMNVIKVPFLPLYVTTCDNDDLPTLEFHSRNNKYTLEPEFYMDPLSD
IDPALCMLYILPVDIDDNTFILGDPFMRKYFTVFDYEKESVGFAVAKNL</Seq>
	</Sequence>
	<Topology numTM="1" reliability="93.7898">
		<Region from="1" to="39" loc="I"/>
		<Region from="40" to="58" loc="M"/>
		<Region from="59" to="449" loc="O"/>
	</Topology>
	<Predictions>
		<Prediction name="HMMTOP">
			<Region from="1" to="39" loc="I"/>
			<Region from="40" to="58" loc="M"/>
			<Region from="59" to="449" loc="O"/>
		</Prediction>
		<Prediction name="Memsat">
			<Region from="1" to="41" loc="I"/>
			<Region from="42" to="59" loc="M"/>
			<Region from="60" to="449" loc="O"/>
		</Prediction>
		<Prediction name="Octopus">
			<Region from="1" to="37" loc="I"/>
			<Region from="38" to="58" loc="M"/>
			<Region from="59" to="449" loc="O"/>
		</Prediction>
		<Prediction name="Philius">
			<Region from="1" to="39" loc="I"/>
			<Region from="40" to="59" loc="M"/>
			<Region from="60" to="449" loc="O"/>
		</Prediction>
		<Prediction name="Phobius">
			<Region from="1" to="39" loc="I"/>
			<Region from="40" to="62" loc="M"/>
			<Region from="63" to="449" loc="O"/>
		</Prediction>
		<Prediction name="Pro">
			<Region from="1" to="37" loc="I"/>
			<Region from="38" to="58" loc="M"/>
			<Region from="59" to="449" loc="O"/>
		</Prediction>
		<Prediction name="Prodiv">
			<Region from="1" to="43" loc="I"/>
			<Region from="44" to="64" loc="M"/>
			<Region from="65" to="130" loc="O"/>
			<Region from="131" to="151" loc="M"/>
			<Region from="152" to="190" loc="I"/>
			<Region from="191" to="211" loc="M"/>
			<Region from="212" to="235" loc="O"/>
			<Region from="236" to="256" loc="M"/>
			<Region from="257" to="278" loc="I"/>
			<Region from="279" to="299" loc="M"/>
			<Region from="300" to="328" loc="O"/>
			<Region from="329" to="349" loc="M"/>
			<Region from="350" to="375" loc="I"/>
			<Region from="376" to="396" loc="M"/>
			<Region from="397" to="449" loc="O"/>
		</Prediction>
		<Prediction name="Scampi">
			<Region from="1" to="37" loc="I"/>
			<Region from="38" to="58" loc="M"/>
			<Region from="59" to="449" loc="O"/>
		</Prediction>
		<Prediction name="ScampiMsa">
			<Region from="1" to="37" loc="I"/>
			<Region from="38" to="57" loc="M"/>
			<Region from="58" to="449" loc="O"/>
		</Prediction>
		<Prediction name="TMHMM">
			<Region from="1" to="39" loc="I"/>
			<Region from="40" to="62" loc="M"/>
			<Region from="63" to="449" loc="O"/>
		</Prediction>
	</Predictions>
</CCTOPItem>
