<?xml version="1.0"?>
<CCTOPItem id="A0A0N4U0G6" transmembrane="yes" evidence="Prediction">
	<Copyright>Copyrighted by the Institute of Enzymology!</Copyright>
	<Sequence length="51" checkSum="301e40cd747b2b9b4e7176be287a7845">
		<Seq>MKTDVCKLETQRLVCNNNQKIVDDLPNKCPFYGNFFVVIFCSSNILFINY
Q</Seq>
	</Sequence>
	<Topology numTM="1" reliability="67.5347">
		<Region from="1" to="29" loc="I"/>
		<Region from="30" to="48" loc="M"/>
		<Region from="49" to="51" loc="O"/>
	</Topology>
	<Predictions>
		<Prediction name="HMMTOP">
			<Region from="1" to="34" loc="O"/>
			<Region from="35" to="50" loc="M"/>
			<Region from="51" to="51" loc="I"/>
		</Prediction>
		<Prediction name="Memsat">
			<Region from="1" to="31" loc="I"/>
			<Region from="32" to="47" loc="M"/>
			<Region from="48" to="51" loc="O"/>
		</Prediction>
		<Prediction name="Octopus">
			<Region from="1" to="29" loc="I"/>
			<Region from="30" to="50" loc="M"/>
			<Region from="51" to="51" loc="O"/>
		</Prediction>
		<Prediction name="Philius">
			<Region from="1" to="29" loc="I"/>
			<Region from="30" to="48" loc="M"/>
			<Region from="49" to="51" loc="O"/>
		</Prediction>
		<Prediction name="Phobius">
			<Region from="1" to="30" loc="O"/>
			<Region from="31" to="50" loc="M"/>
			<Region from="51" to="51" loc="I"/>
		</Prediction>
		<Prediction name="Prodiv">
			<Region from="1" to="28" loc="I"/>
			<Region from="29" to="49" loc="M"/>
			<Region from="50" to="51" loc="O"/>
		</Prediction>
		<Prediction name="Scampi">
			<Region from="1" to="29" loc="I"/>
			<Region from="30" to="50" loc="M"/>
			<Region from="51" to="51" loc="O"/>
		</Prediction>
		<Prediction name="TMHMM">
			<Region from="1" to="30" loc="O"/>
			<Region from="31" to="50" loc="M"/>
			<Region from="51" to="51" loc="I"/>
		</Prediction>
	</Predictions>
</CCTOPItem>
