<?xml version="1.0"?>
<CCTOPItem id="A0A044QJZ8" transmembrane="yes" evidence="Prediction">
	<Copyright>Copyrighted by the Institute of Enzymology!</Copyright>
	<Sequence length="211" checkSum="318801df8a0199464d91d81bba81d305">
		<Seq>MSILNCSNSEDITIAIVFLIIACLIISGHVIHVPSPHVFKSRVKGQVACF
SCVSFTNDFNPRQFYDTNFKFNTSTTALHQTLEKGGILIPKRVPTCVETY
FEHYPKYHQMDVVFCPNTAVEPGSCVTLKGTYNGNQYIYRNCWSKMWIEK
RSYAQHMSERCYDDELVQNFVATNNNKICFCEDDLCNSSNHDRLSNDLCF
IILFVIFLYLY</Seq>
	</Sequence>
	<Topology numTM="1" reliability="56.6341">
		<Region from="1" to="11" loc="I"/>
		<Region from="12" to="31" loc="M"/>
		<Region from="32" to="211" loc="O"/>
	</Topology>
	<Predictions>
		<Prediction name="HMMTOP">
			<Region from="1" to="11" loc="I"/>
			<Region from="12" to="27" loc="M"/>
			<Region from="28" to="194" loc="O"/>
			<Region from="195" to="210" loc="M"/>
			<Region from="211" to="211" loc="I"/>
		</Prediction>
		<Prediction name="Memsat">
			<Region from="1" to="13" loc="O"/>
			<Region from="14" to="31" loc="M"/>
			<Region from="32" to="191" loc="I"/>
			<Region from="192" to="208" loc="M"/>
			<Region from="209" to="211" loc="O"/>
		</Prediction>
		<Prediction name="Octopus">
			<Region from="1" to="12" loc="O"/>
			<Region from="13" to="33" loc="M"/>
			<Region from="34" to="189" loc="I"/>
			<Region from="190" to="210" loc="M"/>
			<Region from="211" to="211" loc="O"/>
		</Prediction>
		<Prediction name="Philius">
			<Region from="1" to="11" loc="I"/>
			<Region from="12" to="33" loc="M"/>
			<Region from="34" to="211" loc="O"/>
		</Prediction>
		<Prediction name="Phobius">
			<Region from="1" to="11" loc="O"/>
			<Region from="12" to="32" loc="M"/>
			<Region from="33" to="193" loc="I"/>
			<Region from="194" to="210" loc="M"/>
			<Region from="211" to="211" loc="O"/>
		</Prediction>
		<Prediction name="Pro">
			<Region from="1" to="11" loc="I"/>
			<Region from="12" to="32" loc="M"/>
			<Region from="33" to="211" loc="O"/>
		</Prediction>
		<Prediction name="Prodiv">
			<Region from="1" to="11" loc="I"/>
			<Region from="12" to="32" loc="M"/>
			<Region from="33" to="211" loc="O"/>
		</Prediction>
		<Prediction name="Scampi">
			<Region from="1" to="11" loc="O"/>
			<Region from="12" to="32" loc="M"/>
			<Region from="33" to="189" loc="I"/>
			<Region from="190" to="210" loc="M"/>
			<Region from="211" to="211" loc="O"/>
		</Prediction>
		<Prediction name="ScampiMsa">
			<Region from="1" to="11" loc="O"/>
			<Region from="12" to="31" loc="M"/>
			<Region from="32" to="189" loc="I"/>
			<Region from="190" to="209" loc="M"/>
			<Region from="210" to="211" loc="O"/>
		</Prediction>
		<Prediction name="TMHMM">
			<Region from="1" to="11" loc="I"/>
			<Region from="12" to="34" loc="M"/>
			<Region from="35" to="211" loc="O"/>
		</Prediction>
	</Predictions>
</CCTOPItem>
