<?xml version="1.0"?>
<CCTOPItem id="A0A0N4U0J6" transmembrane="yes" evidence="3D">
	<Copyright>Copyrighted by the Institute of Enzymology!</Copyright>
	<CrossRef>
		<PDBTM id="4cg5">
			<Chain id="B"/>
		</PDBTM>
		<PDBTM id="4cg6">
			<Chain id="B"/>
		</PDBTM>
		<PDBTM id="4cg7">
			<Chain id="B"/>
		</PDBTM>
		<PDBTM id="5a6u">
			<Chain id="G"/>
		</PDBTM>
		<TOPDB id="AB03611">
			<Alignment>
				<CrossRefSeq>MDQVMQFVEPSRQFVKDSIRLVKRCTKPDRKEFQKIAMATAIGFAIMGFIGFFVKLIHIPINNIIVGG</CrossRefSeq>
				<OrigSeq>MEYIQAVVDPSKQFAKDSIRLVKRCTKPDRKEYQKIAMATAVGFAVMGFIGFFVKLIHIPINNIIVGG</OrigSeq>
			</Alignment>
		</TOPDB>
	</CrossRef>
	<Sequence length="68" checkSum="33a43051e485d19f36c8cbdadb5fbbd2">
		<Seq>MEYIQAVVDPSKQFAKDSIRLVKRCTKPDRKEYQKIAMATAVGFAVMGFI
GFFVKLIHIPINNIIVGG</Seq>
	</Sequence>
	<Topology numTM="1" reliability="91.5021">
		<Region from="1" to="36" loc="I"/>
		<Region from="37" to="54" loc="M"/>
		<Region from="55" to="68" loc="O"/>
	</Topology>
	<Predictions>
		<Prediction name="HMMTOP">
			<Region from="1" to="36" loc="I"/>
			<Region from="37" to="54" loc="M"/>
			<Region from="55" to="68" loc="O"/>
		</Prediction>
		<Prediction name="Memsat">
			<Region from="1" to="36" loc="I"/>
			<Region from="37" to="57" loc="M"/>
			<Region from="58" to="68" loc="O"/>
		</Prediction>
		<Prediction name="Octopus">
			<Region from="1" to="36" loc="I"/>
			<Region from="37" to="57" loc="M"/>
			<Region from="58" to="68" loc="O"/>
		</Prediction>
		<Prediction name="Philius">
			<Region from="1" to="35" loc="I"/>
			<Region from="36" to="59" loc="M"/>
			<Region from="60" to="68" loc="O"/>
		</Prediction>
		<Prediction name="Phobius">
			<Region from="1" to="35" loc="O"/>
			<Region from="36" to="54" loc="M"/>
			<Region from="55" to="68" loc="I"/>
		</Prediction>
		<Prediction name="Pro">
			<Region from="1" to="36" loc="I"/>
			<Region from="37" to="57" loc="M"/>
			<Region from="58" to="68" loc="O"/>
		</Prediction>
		<Prediction name="Prodiv">
			<Region from="1" to="35" loc="I"/>
			<Region from="36" to="56" loc="M"/>
			<Region from="57" to="68" loc="O"/>
		</Prediction>
		<Prediction name="Scampi">
			<Region from="1" to="35" loc="I"/>
			<Region from="36" to="56" loc="M"/>
			<Region from="57" to="68" loc="O"/>
		</Prediction>
		<Prediction name="ScampiMsa">
			<Region from="1" to="35" loc="I"/>
			<Region from="36" to="55" loc="M"/>
			<Region from="56" to="68" loc="O"/>
		</Prediction>
		<Prediction name="TMHMM">
			<Region from="1" to="38" loc="I"/>
			<Region from="39" to="61" loc="M"/>
			<Region from="62" to="68" loc="O"/>
		</Prediction>
	</Predictions>
	<Constraints>
		<Constraint source="TOPDB" sourceId="AB03611">
			<ConstraintRegion from="7" to="7" loc="I" subId="00001" subSource="4cg5B"/>
			<ConstraintRegion from="7" to="7" loc="I" subId="00006" subSource="4cg6B"/>
			<ConstraintRegion from="7" to="7" loc="I" subId="00011" subSource="4cg7B"/>
			<ConstraintRegion from="9" to="9" loc="I" subId="00017" subSource="5a6uG"/>
			<ConstraintRegion from="20" to="36" loc="I" subId="00019" subSource="5a6uG"/>
			<ConstraintRegion from="25" to="30" loc="I" subId="00008" subSource="4cg6B"/>
			<ConstraintRegion from="25" to="36" loc="I" subId="00013" subSource="4cg7B"/>
			<ConstraintRegion from="25" to="37" loc="I" subId="00003" subSource="4cg5B"/>
			<ConstraintRegion from="31" to="54" loc="M" subId="00009" subSource="4cg6B"/>
			<ConstraintRegion from="37" to="51" loc="M" subId="00020" subSource="5a6uG"/>
			<ConstraintRegion from="37" to="54" loc="M" subId="00014" subSource="4cg7B"/>
			<ConstraintRegion from="38" to="58" loc="M" subId="00004" subSource="4cg5B"/>
			<ConstraintRegion from="52" to="68" loc="O" subId="00021" subSource="5a6uG"/>
			<ConstraintRegion from="55" to="68" loc="O" subId="00010" subSource="4cg6B"/>
			<ConstraintRegion from="55" to="68" loc="O" subId="00015" subSource="4cg7B"/>
			<ConstraintRegion from="59" to="68" loc="O" subId="00005" subSource="4cg5B"/>
		</Constraint>
	</Constraints>
</CCTOPItem>
