<?xml version="1.0"?>
<CCTOPItem id="A0A0U5KLL2" transmembrane="yes" evidence="Prediction">
	<Copyright>Copyrighted by the Institute of Enzymology!</Copyright>
	<CrossRef>
		<Signal id="SignalP">
			<Results>1-24</Results>
			<Parameters>0.638105</Parameters>
		</Signal>
	</CrossRef>
	<Sequence length="69" checkSum="3b3af344457282e95f2642f9a9b1f494">
		<Signal from="1" to="24"/>
		<Seq>MLNKLLLQLFILVTIIIIHDVKCGGEEETTTTTLPTTTSVAIKGTISAYT
VMMGLSIYVIHSFIVFKMM</Seq>
	</Sequence>
	<Topology numTM="1" reliability="79.2114">
		<Region from="1" to="24" loc="S"/>
		<Region from="25" to="45" loc="O"/>
		<Region from="46" to="66" loc="M"/>
		<Region from="67" to="69" loc="I"/>
	</Topology>
	<Predictions>
		<Prediction name="HMMTOP">
			<Region from="25" to="45" loc="O"/>
			<Region from="46" to="66" loc="M"/>
			<Region from="67" to="69" loc="I"/>
		</Prediction>
		<Prediction name="Memsat">
			<Region from="25" to="41" loc="I"/>
			<Region from="42" to="66" loc="M"/>
			<Region from="67" to="69" loc="O"/>
		</Prediction>
		<Prediction name="Octopus">
			<Region from="25" to="46" loc="I"/>
			<Region from="47" to="67" loc="M"/>
			<Region from="68" to="69" loc="O"/>
		</Prediction>
		<Prediction name="Philius">
			<Region from="25" to="44" loc="O"/>
			<Region from="45" to="65" loc="M"/>
			<Region from="66" to="69" loc="I"/>
		</Prediction>
		<Prediction name="Phobius">
			<Region from="25" to="45" loc="O"/>
			<Region from="46" to="66" loc="M"/>
			<Region from="67" to="69" loc="I"/>
		</Prediction>
		<Prediction name="Pro">
			<Region from="25" to="44" loc="O"/>
			<Region from="45" to="65" loc="M"/>
			<Region from="66" to="69" loc="I"/>
		</Prediction>
		<Prediction name="Prodiv">
			<Region from="25" to="44" loc="O"/>
			<Region from="45" to="65" loc="M"/>
			<Region from="66" to="69" loc="I"/>
		</Prediction>
		<Prediction name="Scampi">
			<Region from="25" to="47" loc="I"/>
			<Region from="48" to="68" loc="M"/>
			<Region from="69" to="69" loc="O"/>
		</Prediction>
		<Prediction name="ScampiMsa">
			<Region from="25" to="47" loc="I"/>
			<Region from="48" to="67" loc="M"/>
			<Region from="68" to="69" loc="O"/>
		</Prediction>
		<Prediction name="TMHMM">
			<Region from="25" to="43" loc="O"/>
			<Region from="44" to="66" loc="M"/>
			<Region from="67" to="69" loc="I"/>
		</Prediction>
	</Predictions>
	<Constraints>
		<Constraint source="SIGNAL" sourceId="SignalP">
			<ConstraintRegion from="25" to="25" loc="O"/>
		</Constraint>
	</Constraints>
</CCTOPItem>
