<?xml version="1.0"?>
<CCTOPItem id="A0A077YUJ0" transmembrane="yes" evidence="Prediction">
	<Copyright>Copyrighted by the Institute of Enzymology!</Copyright>
	<Sequence length="335" checkSum="4bab01ea63c46ede7e08ffc09aa1ea5a">
		<Seq>MNAAHKYKLQKLLMDDKERITVTYCGQLYDVTPFAQLHPGGASLLRHSDG
MDVRFLLDGSESLDGKSHRHSGSAYRILKGYSVLGAVSATPVPVLCSTVD
SLVDTSRPVVEQIGALKDRYWSWIHEPVCDSLRLFHSSGWESLSRTKWYA
VPSVWMPIVLLLTVGGWNDLRNEGNGVFTTTTWFLTIFISGILCWSLMEY
FIHRYGFHWHPPVDSPKLMAFHFILHGLHHKTPMDKDRLVFPPAVASLIV
VLLFWLYKSSMPWSTCLIFSSGNLFGYVCYDMVHYYLHHGEPAPGTYMHH
LKKYHYNHHFNNQHKAYGISSAIWDYVFGTVGSYQ</Seq>
	</Sequence>
	<Topology numTM="4" reliability="84.3814">
		<Region from="1" to="146" loc="I"/>
		<Region from="147" to="166" loc="M"/>
		<Region from="167" to="179" loc="O"/>
		<Region from="180" to="198" loc="M"/>
		<Region from="199" to="238" loc="I"/>
		<Region from="239" to="257" loc="M"/>
		<Region from="258" to="262" loc="O"/>
		<Region from="263" to="282" loc="M"/>
		<Region from="283" to="335" loc="I"/>
	</Topology>
	<Predictions>
		<Prediction name="HMMTOP">
			<Region from="1" to="145" loc="I"/>
			<Region from="146" to="162" loc="M"/>
			<Region from="163" to="176" loc="O"/>
			<Region from="177" to="198" loc="M"/>
			<Region from="199" to="204" loc="I"/>
			<Region from="205" to="221" loc="M"/>
			<Region from="222" to="238" loc="O"/>
			<Region from="239" to="256" loc="M"/>
			<Region from="257" to="258" loc="I"/>
			<Region from="259" to="279" loc="M"/>
			<Region from="280" to="335" loc="O"/>
		</Prediction>
		<Prediction name="Memsat">
			<Region from="1" to="144" loc="O"/>
			<Region from="145" to="168" loc="M"/>
			<Region from="169" to="174" loc="I"/>
			<Region from="175" to="202" loc="M"/>
			<Region from="203" to="240" loc="O"/>
			<Region from="241" to="261" loc="M"/>
			<Region from="262" to="264" loc="I"/>
			<Region from="265" to="283" loc="M"/>
			<Region from="284" to="335" loc="O"/>
		</Prediction>
		<Prediction name="Octopus">
			<Region from="1" to="145" loc="I"/>
			<Region from="146" to="166" loc="M"/>
			<Region from="167" to="180" loc="O"/>
			<Region from="181" to="201" loc="M"/>
			<Region from="202" to="239" loc="I"/>
			<Region from="240" to="260" loc="M"/>
			<Region from="261" to="261" loc="O"/>
			<Region from="262" to="282" loc="M"/>
			<Region from="283" to="335" loc="I"/>
		</Prediction>
		<Prediction name="Philius">
			<Region from="1" to="147" loc="I"/>
			<Region from="148" to="167" loc="M"/>
			<Region from="168" to="178" loc="O"/>
			<Region from="179" to="202" loc="M"/>
			<Region from="203" to="238" loc="I"/>
			<Region from="239" to="257" loc="M"/>
			<Region from="258" to="264" loc="O"/>
			<Region from="265" to="284" loc="M"/>
			<Region from="285" to="335" loc="I"/>
		</Prediction>
		<Prediction name="Phobius">
			<Region from="1" to="147" loc="I"/>
			<Region from="148" to="167" loc="M"/>
			<Region from="168" to="181" loc="O"/>
			<Region from="182" to="202" loc="M"/>
			<Region from="203" to="238" loc="I"/>
			<Region from="239" to="256" loc="M"/>
			<Region from="257" to="261" loc="O"/>
			<Region from="262" to="280" loc="M"/>
			<Region from="281" to="335" loc="I"/>
		</Prediction>
		<Prediction name="Pro">
			<Region from="1" to="145" loc="I"/>
			<Region from="146" to="166" loc="M"/>
			<Region from="167" to="176" loc="O"/>
			<Region from="177" to="197" loc="M"/>
			<Region from="198" to="238" loc="I"/>
			<Region from="239" to="259" loc="M"/>
			<Region from="260" to="263" loc="O"/>
			<Region from="264" to="284" loc="M"/>
			<Region from="285" to="335" loc="I"/>
		</Prediction>
		<Prediction name="Prodiv">
			<Region from="1" to="143" loc="I"/>
			<Region from="144" to="165" loc="M"/>
			<Region from="166" to="177" loc="O"/>
			<Region from="178" to="198" loc="M"/>
			<Region from="199" to="231" loc="I"/>
			<Region from="232" to="252" loc="M"/>
			<Region from="253" to="262" loc="O"/>
			<Region from="263" to="283" loc="M"/>
			<Region from="284" to="313" loc="I"/>
			<Region from="314" to="334" loc="M"/>
			<Region from="335" to="335" loc="O"/>
		</Prediction>
		<Prediction name="Scampi">
			<Region from="1" to="147" loc="I"/>
			<Region from="148" to="168" loc="M"/>
			<Region from="169" to="177" loc="O"/>
			<Region from="178" to="198" loc="M"/>
			<Region from="199" to="238" loc="I"/>
			<Region from="239" to="259" loc="M"/>
			<Region from="260" to="335" loc="O"/>
		</Prediction>
		<Prediction name="ScampiMsa">
			<Region from="1" to="146" loc="I"/>
			<Region from="147" to="166" loc="M"/>
			<Region from="167" to="181" loc="O"/>
			<Region from="182" to="201" loc="M"/>
			<Region from="202" to="238" loc="I"/>
			<Region from="239" to="258" loc="M"/>
			<Region from="259" to="262" loc="O"/>
			<Region from="263" to="282" loc="M"/>
			<Region from="283" to="335" loc="I"/>
		</Prediction>
		<Prediction name="TMHMM">
			<Region from="1" to="147" loc="I"/>
			<Region from="148" to="167" loc="M"/>
			<Region from="168" to="176" loc="O"/>
			<Region from="177" to="199" loc="M"/>
			<Region from="200" to="238" loc="I"/>
			<Region from="239" to="257" loc="M"/>
			<Region from="258" to="260" loc="O"/>
			<Region from="261" to="280" loc="M"/>
			<Region from="281" to="335" loc="I"/>
		</Prediction>
	</Predictions>
</CCTOPItem>
