<?xml version="1.0"?>
<CCTOPItem id="O24972" transmembrane="yes" evidence="Exists">
	<Copyright>Copyrighted by the Institute of Enzymology!</Copyright>
	<Name>Sensor histidine kinase ArsS {ECO:0000303|PubMed:16672598}</Name>
	<CrossRef>
		<UniProt id="ARSS_HELPY">
			<AC>O24972</AC>
			<AC>O24971</AC>
		</UniProt>
	</CrossRef>
	<Sequence length="427" checkSum="516243d4bc47241f9fb1f1216a42865b">
		<Seq>MRFSIFFKVVALFMITLFSFGAFAYYFVSSQISHENYQNEMRHYQFVTTI
NEILNNYSDYRAIEDYLYKIGFRETTIENLEKVLAKRRHQLHHRNIGYAE
VFKFSDMVFILLKKDEHFVLYKDLHSVSYRNYFLAITVGLLLILFLFLFV
LQSLLPLRELRSQVKPFAQGDKSVSCKSKQKDEIGDLANEFDNCILKINA
MNESRVLFLRSIMHELRTPITKGKILSSMLKEELSCKRFSSIFDHLNMLI
EQFARIEQLASKNYGSNKEKFLMSDLIDKIEKMLLIDEDKESPIHVSSSN
YIIEADFELFSIALKNMVDNAIKYSDDKQVFLDFIGNNLVVSNKSKPLKE
DFEKYLQPYFKSSNPSQAHGFGLGMYIIKNALEAMGLNLSYHYSNGRICF
TIHDCVFNSFYDLEEDNEELPPPPPKI</Seq>
	</Sequence>
	<Topology numTM="2" reliability="56.7213">
		<Region from="1" to="8" loc="I"/>
		<Region from="9" to="28" loc="M"/>
		<Region from="29" to="131" loc="O"/>
		<Region from="132" to="151" loc="M"/>
		<Region from="152" to="427" loc="I"/>
	</Topology>
	<Predictions>
		<Prediction name="HMMTOP">
			<Region from="1" to="8" loc="I"/>
			<Region from="9" to="25" loc="M"/>
			<Region from="26" to="95" loc="O"/>
			<Region from="96" to="112" loc="M"/>
			<Region from="113" to="133" loc="I"/>
			<Region from="134" to="150" loc="M"/>
			<Region from="151" to="427" loc="O"/>
		</Prediction>
		<Prediction name="Memsat">
			<Region from="1" to="14" loc="O"/>
			<Region from="15" to="30" loc="M"/>
			<Region from="31" to="128" loc="I"/>
			<Region from="129" to="151" loc="M"/>
			<Region from="152" to="427" loc="O"/>
		</Prediction>
		<Prediction name="Octopus">
			<Region from="1" to="5" loc="O"/>
			<Region from="6" to="26" loc="M"/>
			<Region from="27" to="128" loc="I"/>
			<Region from="129" to="149" loc="M"/>
			<Region from="150" to="427" loc="O"/>
		</Prediction>
		<Prediction name="Philius">
			<Region from="1" to="6" loc="I"/>
			<Region from="7" to="28" loc="M"/>
			<Region from="29" to="131" loc="O"/>
			<Region from="132" to="155" loc="M"/>
			<Region from="156" to="427" loc="I"/>
		</Prediction>
		<Prediction name="Phobius">
			<Region from="1" to="5" loc="O"/>
			<Region from="6" to="28" loc="M"/>
			<Region from="29" to="95" loc="I"/>
			<Region from="96" to="112" loc="M"/>
			<Region from="113" to="131" loc="O"/>
			<Region from="132" to="155" loc="M"/>
			<Region from="156" to="427" loc="I"/>
		</Prediction>
		<Prediction name="Pro">
			<Region from="1" to="9" loc="I"/>
			<Region from="10" to="30" loc="M"/>
			<Region from="31" to="129" loc="O"/>
			<Region from="130" to="150" loc="M"/>
			<Region from="151" to="427" loc="I"/>
		</Prediction>
		<Prediction name="Prodiv">
			<Region from="1" to="2" loc="I"/>
			<Region from="3" to="24" loc="M"/>
			<Region from="25" to="130" loc="O"/>
			<Region from="131" to="152" loc="M"/>
			<Region from="153" to="427" loc="I"/>
		</Prediction>
		<Prediction name="Scampi">
			<Region from="1" to="8" loc="I"/>
			<Region from="9" to="29" loc="M"/>
			<Region from="30" to="132" loc="O"/>
			<Region from="133" to="153" loc="M"/>
			<Region from="154" to="427" loc="I"/>
		</Prediction>
		<Prediction name="ScampiMsa">
			<Region from="1" to="8" loc="I"/>
			<Region from="9" to="28" loc="M"/>
			<Region from="29" to="129" loc="O"/>
			<Region from="130" to="149" loc="M"/>
			<Region from="150" to="427" loc="I"/>
		</Prediction>
		<Prediction name="TMHMM">
			<Region from="1" to="4" loc="O"/>
			<Region from="5" to="27" loc="M"/>
			<Region from="28" to="131" loc="I"/>
			<Region from="132" to="154" loc="M"/>
			<Region from="155" to="427" loc="O"/>
		</Prediction>
	</Predictions>
</CCTOPItem>
