<?xml version="1.0"?>
<CCTOPItem id="Q6P7R8" transmembrane="yes" evidence="Prediction">
	<Copyright>Copyrighted by the Institute of Enzymology!</Copyright>
	<Name>Very-long-chain 3-oxoacyl-CoA reductase {ECO:0000305}</Name>
	<CrossRef>
		<UniProt id="DHB12_RAT">
			<AC>Q6P7R8</AC>
			<AC>Q9Z1B9</AC>
		</UniProt>
	</CrossRef>
	<Sequence length="312" checkSum="57bfb54db411551c21b229fe7ebfb8a2">
		<Seq>MERALPAAGFLYWVGASTIAYLTLRASYSLFRAFQVWCVGNQAFVGPRLG
EWAVVTGGTDGIGKSYAEELAKRGMKIVLISRSQDKLKEVSNNIKEKFNV
ETRTIAVDFSLDDIYDKIKTGLSGLEIGVLVNNVGMSYEYPEYFLEIPDL
DNTIKKLININVLSICKVTRLVLPGMVERSKGVILNISSASGMLPVPLLT
VYSATKAFVDFFSQCLHEEYKSKGIFVQSVLPFFVATKLAKIRKPTLDKP
SAETFVKSAIKTVGLQTRTTGYVIHAIMGSINSILPRWIYFKTIMGFNKS
LRNRYLKKTKKN</Seq>
	</Sequence>
	<Topology numTM="1" reliability="63.2791">
		<Region from="1" to="7" loc="I"/>
		<Region from="8" to="31" loc="M"/>
		<Region from="32" to="312" loc="O"/>
	</Topology>
	<Predictions>
		<Prediction name="HMMTOP">
			<Region from="1" to="3" loc="O"/>
			<Region from="4" to="24" loc="M"/>
			<Region from="25" to="26" loc="I"/>
			<Region from="27" to="47" loc="M"/>
			<Region from="48" to="275" loc="O"/>
			<Region from="276" to="296" loc="M"/>
			<Region from="297" to="312" loc="I"/>
		</Prediction>
		<Prediction name="Memsat">
			<Region from="1" to="16" loc="O"/>
			<Region from="17" to="32" loc="M"/>
			<Region from="33" to="274" loc="I"/>
			<Region from="275" to="290" loc="M"/>
			<Region from="291" to="312" loc="O"/>
		</Prediction>
		<Prediction name="Octopus">
			<Region from="1" to="10" loc="O"/>
			<Region from="11" to="31" loc="M"/>
			<Region from="32" to="50" loc="I"/>
			<Region from="51" to="71" loc="M"/>
			<Region from="72" to="312" loc="O"/>
		</Prediction>
		<Prediction name="Philius">
			<Region from="1" to="7" loc="I"/>
			<Region from="8" to="27" loc="M"/>
			<Region from="28" to="312" loc="O"/>
		</Prediction>
		<Prediction name="Pro">
			<Region from="1" to="9" loc="I"/>
			<Region from="10" to="30" loc="M"/>
			<Region from="31" to="312" loc="O"/>
		</Prediction>
		<Prediction name="Prodiv">
			<Region from="1" to="9" loc="I"/>
			<Region from="10" to="30" loc="M"/>
			<Region from="31" to="42" loc="O"/>
			<Region from="43" to="63" loc="M"/>
			<Region from="64" to="183" loc="I"/>
			<Region from="184" to="204" loc="M"/>
			<Region from="205" to="280" loc="O"/>
			<Region from="281" to="301" loc="M"/>
			<Region from="302" to="312" loc="I"/>
		</Prediction>
		<Prediction name="Scampi">
			<Region from="1" to="9" loc="I"/>
			<Region from="10" to="30" loc="M"/>
			<Region from="31" to="312" loc="O"/>
		</Prediction>
		<Prediction name="ScampiMsa">
			<Region from="1" to="9" loc="O"/>
			<Region from="10" to="29" loc="M"/>
			<Region from="30" to="312" loc="I"/>
		</Prediction>
		<Prediction name="TMHMM">
			<Region from="1" to="6" loc="I"/>
			<Region from="7" to="24" loc="M"/>
			<Region from="25" to="312" loc="O"/>
		</Prediction>
	</Predictions>
</CCTOPItem>
