<?xml version="1.0"?>
<CCTOPItem id="A0A146MI62" transmembrane="yes" evidence="Prediction">
	<Copyright>Copyrighted by the Institute of Enzymology!</Copyright>
	<Sequence length="68" checkSum="59c4d3481e5b25593edf9393fc94750b">
		<Seq>MVCIPCIVIPVLLWILHRLLYPVVYYFIPRLKPIPQPTTEKSEQLNDLTE
DDVTNACQSSSPSKSKSE</Seq>
	</Sequence>
	<Topology numTM="1" reliability="65.8615">
		<Region from="1" to="1" loc="O"/>
		<Region from="2" to="28" loc="M"/>
		<Region from="29" to="68" loc="I"/>
	</Topology>
	<Predictions>
		<Prediction name="HMMTOP">
			<Region from="1" to="1" loc="O"/>
			<Region from="2" to="28" loc="M"/>
			<Region from="29" to="68" loc="I"/>
		</Prediction>
		<Prediction name="Memsat">
			<Region from="1" to="12" loc="O"/>
			<Region from="13" to="28" loc="M"/>
			<Region from="29" to="68" loc="I"/>
		</Prediction>
		<Prediction name="Octopus">
			<Region from="1" to="1" loc="O"/>
			<Region from="2" to="22" loc="M"/>
			<Region from="23" to="68" loc="I"/>
		</Prediction>
		<Prediction name="Phobius">
			<Region from="1" to="6" loc="I"/>
			<Region from="7" to="28" loc="M"/>
			<Region from="29" to="68" loc="O"/>
		</Prediction>
		<Prediction name="Pro">
			<Region from="1" to="2" loc="I"/>
			<Region from="3" to="23" loc="M"/>
			<Region from="24" to="68" loc="O"/>
		</Prediction>
		<Prediction name="Prodiv">
			<Region from="1" to="5" loc="I"/>
			<Region from="6" to="26" loc="M"/>
			<Region from="27" to="68" loc="O"/>
		</Prediction>
		<Prediction name="Scampi">
			<Region from="1" to="1" loc="O"/>
			<Region from="2" to="22" loc="M"/>
			<Region from="23" to="68" loc="I"/>
		</Prediction>
		<Prediction name="ScampiMsa">
			<Region from="1" to="1" loc="O"/>
			<Region from="2" to="21" loc="M"/>
			<Region from="22" to="68" loc="I"/>
		</Prediction>
		<Prediction name="TMHMM">
			<Region from="1" to="6" loc="I"/>
			<Region from="7" to="29" loc="M"/>
			<Region from="30" to="68" loc="O"/>
		</Prediction>
	</Predictions>
</CCTOPItem>
