<?xml version="1.0"?>
<CCTOPItem id="P9WIM7" transmembrane="yes" evidence="Exists">
	<Copyright>Copyrighted by the Institute of Enzymology!</Copyright>
	<Name>Proline-rich antigen homolog {ECO:0000250|UniProtKB:P41484}</Name>
	<CrossRef>
		<UniProt id="PRA_MYCTU">
			<AC>P9WIM7</AC>
			<AC>L0T785</AC>
			<AC>O53426</AC>
		</UniProt>
	</CrossRef>
	<Sequence length="240" checkSum="5ba93c36be769a38f378682d98579b88">
		<Seq>MTEQPPPGGSYPPPPPPPGPSGGHEPPPAAPPGGSGYAPPPPPSSGSGYP
PPPPPPGGGAYPPPPPSAGGYAPPPPGPAIRTMPTESYTPWITRVLAAFI
DWAPYVVLVGIGWVIMLVTQTSSCVTSISEYDVGQFCVSQPSMIGQLVQW
LLSVGGLAYLVWNYGYRQGTIGSSIGKSVLKFKVVSETTGQPIGFGMSVV
RQLAHFIDAIICFVGFLFPLWDAKRQTLADKIMTTVCVPI</Seq>
	</Sequence>
	<Topology numTM="3" reliability="80.5654">
		<Region from="1" to="96" loc="I"/>
		<Region from="97" to="118" loc="M"/>
		<Region from="119" to="146" loc="O"/>
		<Region from="147" to="165" loc="M"/>
		<Region from="166" to="202" loc="I"/>
		<Region from="203" to="221" loc="M"/>
		<Region from="222" to="240" loc="O"/>
	</Topology>
	<Predictions>
		<Prediction name="HMMTOP">
			<Region from="1" to="94" loc="I"/>
			<Region from="95" to="118" loc="M"/>
			<Region from="119" to="146" loc="O"/>
			<Region from="147" to="162" loc="M"/>
			<Region from="163" to="202" loc="I"/>
			<Region from="203" to="218" loc="M"/>
			<Region from="219" to="240" loc="O"/>
		</Prediction>
		<Prediction name="Memsat">
			<Region from="1" to="93" loc="I"/>
			<Region from="94" to="119" loc="M"/>
			<Region from="120" to="144" loc="O"/>
			<Region from="145" to="161" loc="M"/>
			<Region from="162" to="202" loc="I"/>
			<Region from="203" to="218" loc="M"/>
			<Region from="219" to="240" loc="O"/>
		</Prediction>
		<Prediction name="Octopus">
			<Region from="1" to="98" loc="I"/>
			<Region from="99" to="119" loc="M"/>
			<Region from="120" to="144" loc="O"/>
			<Region from="145" to="165" loc="M"/>
			<Region from="166" to="201" loc="I"/>
			<Region from="202" to="222" loc="M"/>
			<Region from="223" to="240" loc="O"/>
		</Prediction>
		<Prediction name="Philius">
			<Region from="1" to="97" loc="I"/>
			<Region from="98" to="119" loc="M"/>
			<Region from="120" to="145" loc="O"/>
			<Region from="146" to="166" loc="M"/>
			<Region from="167" to="202" loc="I"/>
			<Region from="203" to="223" loc="M"/>
			<Region from="224" to="240" loc="O"/>
		</Prediction>
		<Prediction name="Phobius">
			<Region from="1" to="101" loc="I"/>
			<Region from="102" to="123" loc="M"/>
			<Region from="124" to="142" loc="O"/>
			<Region from="143" to="162" loc="M"/>
			<Region from="163" to="202" loc="I"/>
			<Region from="203" to="221" loc="M"/>
			<Region from="222" to="240" loc="O"/>
		</Prediction>
		<Prediction name="Pro">
			<Region from="1" to="104" loc="O"/>
			<Region from="105" to="125" loc="M"/>
			<Region from="126" to="145" loc="I"/>
			<Region from="146" to="166" loc="M"/>
			<Region from="167" to="202" loc="O"/>
			<Region from="203" to="223" loc="M"/>
			<Region from="224" to="240" loc="I"/>
		</Prediction>
		<Prediction name="Prodiv">
			<Region from="1" to="21" loc="O"/>
			<Region from="22" to="43" loc="M"/>
			<Region from="44" to="49" loc="I"/>
			<Region from="50" to="73" loc="M"/>
			<Region from="74" to="96" loc="O"/>
			<Region from="97" to="118" loc="M"/>
			<Region from="119" to="145" loc="I"/>
			<Region from="146" to="166" loc="M"/>
			<Region from="167" to="198" loc="O"/>
			<Region from="199" to="221" loc="M"/>
			<Region from="222" to="240" loc="I"/>
		</Prediction>
		<Prediction name="Scampi">
			<Region from="1" to="98" loc="I"/>
			<Region from="99" to="119" loc="M"/>
			<Region from="120" to="146" loc="O"/>
			<Region from="147" to="167" loc="M"/>
			<Region from="168" to="202" loc="I"/>
			<Region from="203" to="223" loc="M"/>
			<Region from="224" to="240" loc="O"/>
		</Prediction>
		<Prediction name="ScampiMsa">
			<Region from="1" to="98" loc="I"/>
			<Region from="99" to="118" loc="M"/>
			<Region from="119" to="145" loc="O"/>
			<Region from="146" to="165" loc="M"/>
			<Region from="166" to="202" loc="I"/>
			<Region from="203" to="222" loc="M"/>
			<Region from="223" to="240" loc="O"/>
		</Prediction>
		<Prediction name="TMHMM">
			<Region from="1" to="94" loc="I"/>
			<Region from="95" to="117" loc="M"/>
			<Region from="118" to="198" loc="O"/>
			<Region from="199" to="221" loc="M"/>
			<Region from="222" to="240" loc="I"/>
		</Prediction>
	</Predictions>
</CCTOPItem>
