<?xml version="1.0"?>
<CCTOPItem id="A0A0K0DS15" transmembrane="yes" evidence="Prediction">
	<Copyright>Copyrighted by the Institute of Enzymology!</Copyright>
	<Sequence length="149" checkSum="5d685a7fdd28b3f23951895bd658d4dc">
		<Seq>MCRNILLSKGKTIAIILYIILAGIITCIPVFFMFQSELPSNIWIKYVELR
NYQMLLVSKSSRTFSCKANLIMSNHTRHMYIDFTRLLTFQAFFPIIPILI
PIIFLYIGVAFGFYEEVELYGKKVYQLICSISTVNSILFLILPKKIDVN</Seq>
	</Sequence>
	<Topology numTM="3" reliability="92.929">
		<Region from="1" to="12" loc="I"/>
		<Region from="13" to="34" loc="M"/>
		<Region from="35" to="90" loc="O"/>
		<Region from="91" to="112" loc="M"/>
		<Region from="113" to="126" loc="I"/>
		<Region from="127" to="142" loc="M"/>
		<Region from="143" to="149" loc="O"/>
	</Topology>
	<Predictions>
		<Prediction name="HMMTOP">
			<Region from="1" to="11" loc="I"/>
			<Region from="12" to="34" loc="M"/>
			<Region from="35" to="90" loc="O"/>
			<Region from="91" to="113" loc="M"/>
			<Region from="114" to="126" loc="I"/>
			<Region from="127" to="142" loc="M"/>
			<Region from="143" to="149" loc="O"/>
		</Prediction>
		<Prediction name="Memsat">
			<Region from="1" to="12" loc="I"/>
			<Region from="13" to="34" loc="M"/>
			<Region from="35" to="85" loc="O"/>
			<Region from="86" to="111" loc="M"/>
			<Region from="112" to="124" loc="I"/>
			<Region from="125" to="142" loc="M"/>
			<Region from="143" to="149" loc="O"/>
		</Prediction>
		<Prediction name="Octopus">
			<Region from="1" to="11" loc="I"/>
			<Region from="12" to="32" loc="M"/>
			<Region from="33" to="90" loc="O"/>
			<Region from="91" to="111" loc="M"/>
			<Region from="112" to="149" loc="I"/>
		</Prediction>
		<Prediction name="Philius">
			<Region from="1" to="12" loc="I"/>
			<Region from="13" to="34" loc="M"/>
			<Region from="35" to="90" loc="O"/>
			<Region from="91" to="114" loc="M"/>
			<Region from="115" to="123" loc="I"/>
			<Region from="124" to="143" loc="M"/>
			<Region from="144" to="149" loc="O"/>
		</Prediction>
		<Prediction name="Phobius">
			<Region from="1" to="11" loc="I"/>
			<Region from="12" to="34" loc="M"/>
			<Region from="35" to="90" loc="O"/>
			<Region from="91" to="112" loc="M"/>
			<Region from="113" to="123" loc="I"/>
			<Region from="124" to="142" loc="M"/>
			<Region from="143" to="149" loc="O"/>
		</Prediction>
		<Prediction name="Pro">
			<Region from="1" to="11" loc="I"/>
			<Region from="12" to="32" loc="M"/>
			<Region from="33" to="90" loc="O"/>
			<Region from="91" to="111" loc="M"/>
			<Region from="112" to="149" loc="I"/>
		</Prediction>
		<Prediction name="Prodiv">
			<Region from="1" to="11" loc="I"/>
			<Region from="12" to="34" loc="M"/>
			<Region from="35" to="90" loc="O"/>
			<Region from="91" to="111" loc="M"/>
			<Region from="112" to="122" loc="I"/>
			<Region from="123" to="143" loc="M"/>
			<Region from="144" to="149" loc="O"/>
		</Prediction>
		<Prediction name="Scampi">
			<Region from="1" to="13" loc="I"/>
			<Region from="14" to="34" loc="M"/>
			<Region from="35" to="90" loc="O"/>
			<Region from="91" to="111" loc="M"/>
			<Region from="112" to="123" loc="I"/>
			<Region from="124" to="144" loc="M"/>
			<Region from="145" to="149" loc="O"/>
		</Prediction>
		<Prediction name="ScampiMsa">
			<Region from="1" to="13" loc="I"/>
			<Region from="14" to="33" loc="M"/>
			<Region from="34" to="90" loc="O"/>
			<Region from="91" to="110" loc="M"/>
			<Region from="111" to="123" loc="I"/>
			<Region from="124" to="143" loc="M"/>
			<Region from="144" to="149" loc="O"/>
		</Prediction>
		<Prediction name="TMHMM">
			<Region from="1" to="12" loc="I"/>
			<Region from="13" to="35" loc="M"/>
			<Region from="36" to="88" loc="O"/>
			<Region from="89" to="111" loc="M"/>
			<Region from="112" to="123" loc="I"/>
			<Region from="124" to="143" loc="M"/>
			<Region from="144" to="149" loc="O"/>
		</Prediction>
	</Predictions>
</CCTOPItem>
