<?xml version="1.0"?>
<CCTOPItem id="L7N697" transmembrane="yes" evidence="Exists">
	<Copyright>Copyrighted by the Institute of Enzymology!</Copyright>
	<Name>Esterase PE16 {ECO:0000305}</Name>
	<CrossRef>
		<UniProt id="PE16_MYCTU">
			<AC>L7N697</AC>
			<AC>I6XBG6</AC>
		</UniProt>
	</CrossRef>
	<Sequence length="528" checkSum="60abf0a4f3709090e9ac6ddf25a0e0af">
		<Seq>MSFVFAVPEMVAATASDLASLGAALSEATAAAAIPTTQVLAAAADEVSAA
IAELFGAHGQEFQALSAQASAFHDRFVRALSAAAGWYVDAEAANAALVDT
AATGASELGSGGRTALILGSTGTPRPPFDYMQQVYDRYIAPHYLGYAFSG
LYTPAQFQPWTGIPSLTYDQSVAEGAGYLHTAIMQQVAAGNDVVVLGFSQ
GASVATLEMRHLASLPAGVAPSPDQLSFVLLGNPNNPNGGILARFPGLYL
QSLGLTFNGATPDTDYATTIYTTQYDGFADFPKYPLNILADVNALLGIYY
SHSLYYGLTPEQVASGIVLPVSSPDTNTTYILLPNEDLPLLQPLRGIVPE
PLLDLIEPDLRAIIELGYDRTGYADVPTPAALFPVHIDPIAVPPQIGAAI
GGPLTALDGLLDTVINDQLNPVVTSGIYQAGAELSVAAAGYGAPAGVTNA
IFIGQQVLPILVEGPGALVTADTHYLVDAIQDLAAGDLSGFNQNLQLIPA
TNIALLVFAAGIPAVAAVAILTGQDFPV</Seq>
	</Sequence>
	<Topology numTM="2" reliability="55.3385">
		<Region from="1" to="293" loc="I"/>
		<Region from="294" to="309" loc="M"/>
		<Region from="310" to="502" loc="O"/>
		<Region from="503" to="522" loc="M"/>
		<Region from="523" to="528" loc="I"/>
	</Topology>
	<Predictions>
		<Prediction name="HMMTOP">
			<Region from="1" to="502" loc="I"/>
			<Region from="503" to="522" loc="M"/>
			<Region from="523" to="528" loc="O"/>
		</Prediction>
		<Prediction name="Octopus">
			<Region from="1" to="498" loc="I"/>
			<Region from="499" to="519" loc="M"/>
			<Region from="520" to="528" loc="O"/>
		</Prediction>
		<Prediction name="Philius">
			<Region from="1" to="33" loc="S"/>
			<Region from="34" to="499" loc="O"/>
			<Region from="500" to="522" loc="M"/>
			<Region from="523" to="528" loc="I"/>
		</Prediction>
		<Prediction name="Phobius">
			<Region from="1" to="502" loc="O"/>
			<Region from="503" to="522" loc="M"/>
			<Region from="523" to="528" loc="I"/>
		</Prediction>
		<Prediction name="Pro">
			<Region from="1" to="502" loc="I"/>
			<Region from="503" to="523" loc="M"/>
			<Region from="524" to="528" loc="O"/>
		</Prediction>
		<Prediction name="Prodiv">
			<Region from="1" to="11" loc="I"/>
			<Region from="12" to="32" loc="M"/>
			<Region from="33" to="37" loc="O"/>
			<Region from="38" to="58" loc="M"/>
			<Region from="59" to="78" loc="I"/>
			<Region from="79" to="99" loc="M"/>
			<Region from="100" to="101" loc="O"/>
			<Region from="102" to="122" loc="M"/>
			<Region from="123" to="137" loc="I"/>
			<Region from="138" to="158" loc="M"/>
			<Region from="159" to="163" loc="O"/>
			<Region from="164" to="184" loc="M"/>
			<Region from="185" to="209" loc="I"/>
			<Region from="210" to="230" loc="M"/>
			<Region from="231" to="251" loc="O"/>
			<Region from="252" to="272" loc="M"/>
			<Region from="273" to="293" loc="I"/>
			<Region from="294" to="314" loc="M"/>
			<Region from="315" to="335" loc="O"/>
			<Region from="336" to="356" loc="M"/>
			<Region from="357" to="362" loc="I"/>
			<Region from="363" to="383" loc="M"/>
			<Region from="384" to="388" loc="O"/>
			<Region from="389" to="409" loc="M"/>
			<Region from="410" to="429" loc="I"/>
			<Region from="430" to="450" loc="M"/>
			<Region from="451" to="455" loc="O"/>
			<Region from="456" to="476" loc="M"/>
			<Region from="477" to="496" loc="I"/>
			<Region from="497" to="517" loc="M"/>
			<Region from="518" to="528" loc="O"/>
		</Prediction>
		<Prediction name="Scampi">
			<Region from="1" to="502" loc="I"/>
			<Region from="503" to="523" loc="M"/>
			<Region from="524" to="528" loc="O"/>
		</Prediction>
		<Prediction name="ScampiMsa">
			<Region from="1" to="287" loc="I"/>
			<Region from="288" to="307" loc="M"/>
			<Region from="308" to="502" loc="O"/>
			<Region from="503" to="522" loc="M"/>
			<Region from="523" to="528" loc="I"/>
		</Prediction>
		<Prediction name="TMHMM">
			<Region from="1" to="499" loc="O"/>
			<Region from="500" to="522" loc="M"/>
			<Region from="523" to="528" loc="I"/>
		</Prediction>
	</Predictions>
</CCTOPItem>
