<?xml version="1.0"?>
<CCTOPItem id="P16464" transmembrane="yes" evidence="Prediction">
	<Copyright>Copyrighted by the Institute of Enzymology!</Copyright>
	<Name>Female-specific protein 800</Name>
	<CrossRef>
		<UniProt id="F802_SCHMA">
			<AC>P16464</AC>
		</UniProt>
	</CrossRef>
	<Sequence length="132" checkSum="6140b818e35c2ca0915ddcaaaa8d81eb">
		<Seq>MIIIIKIRINIHIIILTIIIIKGTINLRMSIVNQNKIHITKKQGIIMMMM
MMMKILKEIKNLFDLDIMVIHIGMIKFNLVEIVQKVAVIQKVHISHYILE
QIDMVDEMIIHDFKHVDDPMVIVKICFLTFLM</Seq>
	</Sequence>
	<Topology numTM="1" reliability="61.3077">
		<Region from="1" to="8" loc="I"/>
		<Region from="9" to="27" loc="M"/>
		<Region from="28" to="132" loc="O"/>
	</Topology>
	<Predictions>
		<Prediction name="HMMTOP">
			<Region from="1" to="12" loc="O"/>
			<Region from="13" to="32" loc="M"/>
			<Region from="33" to="61" loc="I"/>
			<Region from="62" to="80" loc="M"/>
			<Region from="81" to="132" loc="O"/>
		</Prediction>
		<Prediction name="Memsat">
			<Region from="1" to="5" loc="O"/>
			<Region from="6" to="23" loc="M"/>
			<Region from="24" to="67" loc="I"/>
			<Region from="68" to="83" loc="M"/>
			<Region from="84" to="132" loc="O"/>
		</Prediction>
		<Prediction name="Octopus">
			<Region from="1" to="4" loc="I"/>
			<Region from="5" to="25" loc="M"/>
			<Region from="26" to="132" loc="O"/>
		</Prediction>
		<Prediction name="Philius">
			<Region from="1" to="8" loc="I"/>
			<Region from="9" to="27" loc="M"/>
			<Region from="28" to="132" loc="O"/>
		</Prediction>
		<Prediction name="Phobius">
			<Region from="1" to="6" loc="I"/>
			<Region from="7" to="25" loc="M"/>
			<Region from="26" to="132" loc="O"/>
		</Prediction>
		<Prediction name="Prodiv">
			<Region from="1" to="6" loc="I"/>
			<Region from="7" to="27" loc="M"/>
			<Region from="28" to="37" loc="O"/>
			<Region from="38" to="59" loc="M"/>
			<Region from="60" to="132" loc="I"/>
		</Prediction>
		<Prediction name="Scampi">
			<Region from="1" to="4" loc="O"/>
			<Region from="5" to="25" loc="M"/>
			<Region from="26" to="61" loc="I"/>
			<Region from="62" to="82" loc="M"/>
			<Region from="83" to="132" loc="O"/>
		</Prediction>
		<Prediction name="ScampiMsa">
			<Region from="1" to="4" loc="O"/>
			<Region from="5" to="24" loc="M"/>
			<Region from="25" to="61" loc="I"/>
			<Region from="62" to="81" loc="M"/>
			<Region from="82" to="132" loc="O"/>
		</Prediction>
		<Prediction name="TMHMM">
			<Region from="1" to="9" loc="O"/>
			<Region from="10" to="32" loc="M"/>
			<Region from="33" to="132" loc="I"/>
		</Prediction>
	</Predictions>
</CCTOPItem>
