<?xml version="1.0"?>
<CCTOPItem id="A0A183XCD6" transmembrane="yes" evidence="Prediction">
	<Copyright>Copyrighted by the Institute of Enzymology!</Copyright>
	<Sequence length="145" checkSum="66357ed16f88e409ab52b7f0b1696bf2">
		<Seq>MWHMCAALLRTLRLLFILHLMLCNYLCASKRYKRYYQKHFNLTLSVRNHD
VTEAKFFRLIGVGNTADFYVAPGDIFTKTYEAKRKGFWTLFVEFPGNRYS
KSPRKVISRDSHKHWIIEVYYYPGAVGFSKWHKVYDEMFKNKILY</Seq>
	</Sequence>
	<Topology numTM="1" reliability="71.8952">
		<Region from="1" to="6" loc="O"/>
		<Region from="7" to="28" loc="M"/>
		<Region from="29" to="145" loc="I"/>
	</Topology>
	<Predictions>
		<Prediction name="HMMTOP">
			<Region from="1" to="13" loc="I"/>
			<Region from="14" to="29" loc="M"/>
			<Region from="30" to="145" loc="O"/>
		</Prediction>
		<Prediction name="Memsat">
			<Region from="1" to="14" loc="O"/>
			<Region from="15" to="30" loc="M"/>
			<Region from="31" to="145" loc="I"/>
		</Prediction>
		<Prediction name="Octopus">
			<Region from="1" to="4" loc="I"/>
			<Region from="5" to="25" loc="M"/>
			<Region from="26" to="145" loc="O"/>
		</Prediction>
		<Prediction name="Phobius">
			<Region from="1" to="11" loc="O"/>
			<Region from="12" to="28" loc="M"/>
			<Region from="29" to="145" loc="I"/>
		</Prediction>
		<Prediction name="Pro">
			<Region from="1" to="4" loc="O"/>
			<Region from="5" to="25" loc="M"/>
			<Region from="26" to="145" loc="I"/>
		</Prediction>
		<Prediction name="Prodiv">
			<Region from="1" to="4" loc="O"/>
			<Region from="5" to="26" loc="M"/>
			<Region from="27" to="145" loc="I"/>
		</Prediction>
		<Prediction name="Scampi">
			<Region from="1" to="7" loc="O"/>
			<Region from="8" to="28" loc="M"/>
			<Region from="29" to="145" loc="I"/>
		</Prediction>
		<Prediction name="ScampiMsa">
			<Region from="1" to="7" loc="O"/>
			<Region from="8" to="27" loc="M"/>
			<Region from="28" to="145" loc="I"/>
		</Prediction>
		<Prediction name="TMHMM">
			<Region from="1" to="5" loc="O"/>
			<Region from="6" to="28" loc="M"/>
			<Region from="29" to="145" loc="I"/>
		</Prediction>
	</Predictions>
</CCTOPItem>
