<?xml version="1.0"?>
<CCTOPItem id="P23126" transmembrane="yes" evidence="Exists">
	<Copyright>Copyrighted by the Institute of Enzymology!</Copyright>
	<Name>Antigenic integral membrane glycoprotein</Name>
	<CrossRef>
		<UniProt id="SM25_SCHMA">
			<AC>P23126</AC>
		</UniProt>
	</CrossRef>
	<Sequence length="182" checkSum="66f20b0768b17e7ab0d7fcc1e75b8293">
		<Seq>MFSFHERMKKKHVTIRVYKHERILVFLFVLFISTTDFSTEIIMIQTINWI
VWKLFIIYISLDLFSLKLVNSEENSNSIITDEDYDHYNSSLDSSNNVKHS
QEAFHRNSDPDGFPEYEFLNETSIEIKEELGQELHQLQLILDELSRRIRA
TPNSANKYMKNEFLMSSCIVITLNLFIFMYKS</Seq>
	</Sequence>
	<Topology numTM="3" reliability="83.3385">
		<Region from="1" to="22" loc="I"/>
		<Region from="23" to="39" loc="M"/>
		<Region from="40" to="49" loc="O"/>
		<Region from="50" to="66" loc="M"/>
		<Region from="67" to="162" loc="I"/>
		<Region from="163" to="179" loc="M"/>
		<Region from="180" to="182" loc="O"/>
	</Topology>
	<Predictions>
		<Prediction name="HMMTOP">
			<Region from="1" to="22" loc="I"/>
			<Region from="23" to="44" loc="M"/>
			<Region from="45" to="162" loc="O"/>
			<Region from="163" to="178" loc="M"/>
			<Region from="179" to="182" loc="I"/>
		</Prediction>
		<Prediction name="Memsat">
			<Region from="1" to="23" loc="I"/>
			<Region from="24" to="39" loc="M"/>
			<Region from="40" to="42" loc="O"/>
			<Region from="43" to="61" loc="M"/>
			<Region from="62" to="162" loc="I"/>
			<Region from="163" to="179" loc="M"/>
			<Region from="180" to="182" loc="O"/>
		</Prediction>
		<Prediction name="Octopus">
			<Region from="1" to="19" loc="I"/>
			<Region from="20" to="40" loc="M"/>
			<Region from="41" to="43" loc="O"/>
			<Region from="44" to="64" loc="M"/>
			<Region from="65" to="160" loc="I"/>
			<Region from="161" to="181" loc="M"/>
			<Region from="182" to="182" loc="O"/>
		</Prediction>
		<Prediction name="Philius">
			<Region from="1" to="20" loc="I"/>
			<Region from="21" to="42" loc="M"/>
			<Region from="43" to="48" loc="O"/>
			<Region from="49" to="69" loc="M"/>
			<Region from="70" to="162" loc="I"/>
			<Region from="163" to="180" loc="M"/>
			<Region from="181" to="182" loc="O"/>
		</Prediction>
		<Prediction name="Phobius">
			<Region from="1" to="20" loc="I"/>
			<Region from="21" to="44" loc="M"/>
			<Region from="45" to="49" loc="O"/>
			<Region from="50" to="69" loc="M"/>
			<Region from="70" to="162" loc="I"/>
			<Region from="163" to="180" loc="M"/>
			<Region from="181" to="182" loc="O"/>
		</Prediction>
		<Prediction name="Pro">
			<Region from="1" to="20" loc="I"/>
			<Region from="21" to="41" loc="M"/>
			<Region from="42" to="45" loc="O"/>
			<Region from="46" to="66" loc="M"/>
			<Region from="67" to="182" loc="I"/>
		</Prediction>
		<Prediction name="Prodiv">
			<Region from="1" to="23" loc="I"/>
			<Region from="24" to="44" loc="M"/>
			<Region from="45" to="48" loc="O"/>
			<Region from="49" to="69" loc="M"/>
			<Region from="70" to="158" loc="I"/>
			<Region from="159" to="179" loc="M"/>
			<Region from="180" to="182" loc="O"/>
		</Prediction>
		<Prediction name="Scampi">
			<Region from="1" to="16" loc="I"/>
			<Region from="17" to="37" loc="M"/>
			<Region from="38" to="45" loc="O"/>
			<Region from="46" to="66" loc="M"/>
			<Region from="67" to="160" loc="I"/>
			<Region from="161" to="181" loc="M"/>
			<Region from="182" to="182" loc="O"/>
		</Prediction>
		<Prediction name="ScampiMsa">
			<Region from="1" to="16" loc="I"/>
			<Region from="17" to="36" loc="M"/>
			<Region from="37" to="45" loc="O"/>
			<Region from="46" to="65" loc="M"/>
			<Region from="66" to="160" loc="I"/>
			<Region from="161" to="180" loc="M"/>
			<Region from="181" to="182" loc="O"/>
		</Prediction>
		<Prediction name="TMHMM">
			<Region from="1" to="22" loc="I"/>
			<Region from="23" to="45" loc="M"/>
			<Region from="46" to="48" loc="O"/>
			<Region from="49" to="71" loc="M"/>
			<Region from="72" to="162" loc="I"/>
			<Region from="163" to="180" loc="M"/>
			<Region from="181" to="182" loc="O"/>
		</Prediction>
	</Predictions>
</CCTOPItem>
