<?xml version="1.0"?>
<CCTOPItem id="Q53GQ0" transmembrane="yes" evidence="Exists">
	<Copyright>Copyrighted by the Institute of Enzymology!</Copyright>
	<Name>Very-long-chain 3-oxoacyl-CoA reductase {ECO:0000305}</Name>
	<CrossRef>
		<UniProt id="DHB12_HUMAN">
			<AC>Q53GQ0</AC>
			<AC>A8K9B0</AC>
			<AC>D3DR23</AC>
			<AC>Q96EA9</AC>
			<AC>Q96JU2</AC>
			<AC>Q9Y6G8</AC>
		</UniProt>
	</CrossRef>
	<Sequence length="312" checkSum="673576a128c39427c88d07b87cc44a72">
		<Seq>MESALPAAGFLYWVGAGTVAYLALRISYSLFTALRVWGVGNEAGVGPGLG
EWAVVTGSTDGIGKSYAEELAKHGMKVVLISRSKDKLDQVSSEIKEKFKV
ETRTIAVDFASEDIYDKIKTGLAGLEIGILVNNVGMSYEYPEYFLDVPDL
DNVIKKMININILSVCKMTQLVLPGMVERSKGAILNISSGSGMLPVPLLT
IYSATKTFVDFFSQCLHEEYRSKGVFVQSVLPYFVATKLAKIRKPTLDKP
SPETFVKSAIKTVGLQSRTNGYLIHALMGSIISNLPSWIYLKIVMNMNKS
TRAHYLKKTKKN</Seq>
	</Sequence>
	<Topology numTM="3" reliability="63.9645">
		<Region from="1" to="9" loc="O"/>
		<Region from="10" to="28" loc="M"/>
		<Region from="29" to="182" loc="I"/>
		<Region from="183" to="200" loc="M"/>
		<Region from="201" to="276" loc="O"/>
		<Region from="277" to="294" loc="M"/>
		<Region from="295" to="312" loc="I"/>
	</Topology>
	<Predictions>
		<Prediction name="HMMTOP">
			<Region from="1" to="3" loc="O"/>
			<Region from="4" to="24" loc="M"/>
			<Region from="25" to="26" loc="I"/>
			<Region from="27" to="47" loc="M"/>
			<Region from="48" to="275" loc="O"/>
			<Region from="276" to="296" loc="M"/>
			<Region from="297" to="312" loc="I"/>
		</Prediction>
		<Prediction name="Memsat">
			<Region from="1" to="276" loc="O"/>
			<Region from="277" to="292" loc="M"/>
			<Region from="293" to="312" loc="I"/>
		</Prediction>
		<Prediction name="Octopus">
			<Region from="1" to="10" loc="O"/>
			<Region from="11" to="31" loc="M"/>
			<Region from="32" to="50" loc="I"/>
			<Region from="51" to="71" loc="M"/>
			<Region from="72" to="312" loc="O"/>
		</Prediction>
		<Prediction name="Philius">
			<Region from="1" to="7" loc="O"/>
			<Region from="8" to="28" loc="M"/>
			<Region from="29" to="182" loc="I"/>
			<Region from="183" to="202" loc="M"/>
			<Region from="203" to="271" loc="O"/>
			<Region from="272" to="294" loc="M"/>
			<Region from="295" to="312" loc="I"/>
		</Prediction>
		<Prediction name="Phobius">
			<Region from="1" to="5" loc="O"/>
			<Region from="6" to="24" loc="M"/>
			<Region from="25" to="182" loc="I"/>
			<Region from="183" to="204" loc="M"/>
			<Region from="205" to="271" loc="O"/>
			<Region from="272" to="291" loc="M"/>
			<Region from="292" to="312" loc="I"/>
		</Prediction>
		<Prediction name="Pro">
			<Region from="1" to="9" loc="I"/>
			<Region from="10" to="30" loc="M"/>
			<Region from="31" to="312" loc="O"/>
		</Prediction>
		<Prediction name="Prodiv">
			<Region from="1" to="9" loc="I"/>
			<Region from="10" to="30" loc="M"/>
			<Region from="31" to="45" loc="O"/>
			<Region from="46" to="66" loc="M"/>
			<Region from="67" to="183" loc="I"/>
			<Region from="184" to="204" loc="M"/>
			<Region from="205" to="312" loc="O"/>
		</Prediction>
		<Prediction name="Scampi">
			<Region from="1" to="9" loc="I"/>
			<Region from="10" to="30" loc="M"/>
			<Region from="31" to="270" loc="O"/>
			<Region from="271" to="291" loc="M"/>
			<Region from="292" to="312" loc="I"/>
		</Prediction>
		<Prediction name="ScampiMsa">
			<Region from="1" to="9" loc="O"/>
			<Region from="10" to="29" loc="M"/>
			<Region from="30" to="312" loc="I"/>
		</Prediction>
		<Prediction name="TMHMM">
			<Region from="1" to="3" loc="O"/>
			<Region from="4" to="26" loc="M"/>
			<Region from="27" to="181" loc="I"/>
			<Region from="182" to="204" loc="M"/>
			<Region from="205" to="271" loc="O"/>
			<Region from="272" to="294" loc="M"/>
			<Region from="295" to="312" loc="I"/>
		</Prediction>
	</Predictions>
</CCTOPItem>
