<?xml version="1.0"?>
<CCTOPItem id="O53505" transmembrane="yes" evidence="Exists">
	<Copyright>Copyrighted by the Institute of Enzymology!</Copyright>
	<Name>Protein LppM</Name>
	<CrossRef>
		<UniProt id="LPPM_MYCTU">
			<AC>O53505</AC>
			<AC>F2GK01</AC>
			<AC>I6XDJ6</AC>
			<AC>L0TAE3</AC>
		</UniProt>
		<Signal id="SignalP">
			<Results>1-25</Results>
			<Parameters>1.00004</Parameters>
		</Signal>
	</CrossRef>
	<Sequence length="227" checkSum="688bf58144b8432f997c7d9175454962">
		<Signal from="1" to="25"/>
		<Seq>MARTRRRGMLAIAMLLMLVPLATGCLRVRASITISPDDLVSGEIIAAAKP
KNSKDTGPALDGDVPFSQKVAVSNYDSDGYVGSQAVFSDLTFAELPQLAN
MNSDAAGVNLSLRRNGNIVILEGRADLTSVSDPDADVELTVAFPAAVTST
NGDRIEPEVVQWKLKPGVVSTMSAQARYTDPNTRSFTGAGIWLGIAAFAA
AGVVAVLAWIDRDRSPRLTASGDPPTS</Seq>
	</Sequence>
	<Topology numTM="1" reliability="64.0076">
		<Region from="1" to="25" loc="S"/>
		<Region from="26" to="188" loc="O"/>
		<Region from="189" to="210" loc="M"/>
		<Region from="211" to="227" loc="I"/>
	</Topology>
	<Predictions>
		<Prediction name="HMMTOP">
			<Region from="26" to="188" loc="O"/>
			<Region from="189" to="210" loc="M"/>
			<Region from="211" to="227" loc="I"/>
		</Prediction>
		<Prediction name="Memsat">
			<Region from="26" to="188" loc="O"/>
			<Region from="189" to="204" loc="M"/>
			<Region from="205" to="227" loc="I"/>
		</Prediction>
		<Prediction name="Octopus">
			<Region from="26" to="186" loc="I"/>
			<Region from="187" to="207" loc="M"/>
			<Region from="208" to="227" loc="O"/>
		</Prediction>
		<Prediction name="Philius">
			<Region from="26" to="187" loc="O"/>
			<Region from="188" to="210" loc="M"/>
			<Region from="211" to="227" loc="I"/>
		</Prediction>
		<Prediction name="Phobius">
			<Region from="26" to="188" loc="O"/>
			<Region from="189" to="210" loc="M"/>
			<Region from="211" to="227" loc="I"/>
		</Prediction>
		<Prediction name="Pro">
			<Region from="26" to="185" loc="I"/>
			<Region from="186" to="206" loc="M"/>
			<Region from="207" to="227" loc="O"/>
		</Prediction>
		<Prediction name="Prodiv">
			<Region from="26" to="187" loc="I"/>
			<Region from="188" to="208" loc="M"/>
			<Region from="209" to="227" loc="O"/>
		</Prediction>
		<Prediction name="Scampi">
			<Region from="26" to="190" loc="O"/>
			<Region from="191" to="211" loc="M"/>
			<Region from="212" to="227" loc="I"/>
		</Prediction>
		<Prediction name="ScampiMsa">
			<Region from="26" to="190" loc="O"/>
			<Region from="191" to="210" loc="M"/>
			<Region from="211" to="227" loc="I"/>
		</Prediction>
		<Prediction name="TMHMM">
			<Region from="26" to="187" loc="I"/>
			<Region from="188" to="210" loc="M"/>
			<Region from="211" to="227" loc="O"/>
		</Prediction>
	</Predictions>
	<Constraints>
		<Constraint source="SIGNAL" sourceId="SignalP">
			<ConstraintRegion from="26" to="26" loc="O"/>
		</Constraint>
	</Constraints>
</CCTOPItem>
