<?xml version="1.0"?>
<CCTOPItem id="A0A044QK47" transmembrane="yes" evidence="Prediction">
	<Copyright>Copyrighted by the Institute of Enzymology!</Copyright>
	<Sequence length="424" checkSum="69deb2d28e1c2e674adc06474cedd031">
		<Seq>MAMTIKEDFKLQQKEAEAMKRAMTIKEDFKLQQKEAEAMKRAAFFGITVS
TMATLTSIIAVPLLYNYMHHIQSSLEVEVHYCKHLTNNLWQQFDKIQLST
NNGNIHTNDRLKRQVIWRITGKKRKTRKQNQRPKIQVYSVREEIVPYNGD
NVKEEEERKKNDNKDKELINKEMISSDTYETYNGNEKISVKENDSTRKVA
EVYQIQNDNEYSNAGAKIGISEAVSNKDGKVDRKCAVGAVGPPGPPGDDG
ENGADGLPGADGLPGEDAEPGVMQEPEEFCFYCLPGPAGPAGPRGPKGIP
GPAGKRGKIGKVNLLPGPPGFPGPPGTPGPPGLPGTCGLPGVISGHVELQ
GPPGPLGPVGPPGNVGQPGAIGCESIGPRGPPGDPGQDGEPGLSGLNGNP
GLPGEPGTNGSCDHCPRPRTAPGF</Seq>
	</Sequence>
	<Topology numTM="1" reliability="84.4694">
		<Region from="1" to="42" loc="I"/>
		<Region from="43" to="64" loc="M"/>
		<Region from="65" to="424" loc="O"/>
	</Topology>
	<Predictions>
		<Prediction name="HMMTOP">
			<Region from="1" to="41" loc="I"/>
			<Region from="42" to="64" loc="M"/>
			<Region from="65" to="210" loc="O"/>
			<Region from="211" to="226" loc="M"/>
			<Region from="227" to="424" loc="I"/>
		</Prediction>
		<Prediction name="Memsat">
			<Region from="1" to="44" loc="I"/>
			<Region from="45" to="69" loc="M"/>
			<Region from="70" to="424" loc="O"/>
		</Prediction>
		<Prediction name="Octopus">
			<Region from="1" to="42" loc="I"/>
			<Region from="43" to="63" loc="M"/>
			<Region from="64" to="424" loc="O"/>
		</Prediction>
		<Prediction name="Philius">
			<Region from="1" to="42" loc="I"/>
			<Region from="43" to="65" loc="M"/>
			<Region from="66" to="424" loc="O"/>
		</Prediction>
		<Prediction name="Phobius">
			<Region from="1" to="41" loc="I"/>
			<Region from="42" to="65" loc="M"/>
			<Region from="66" to="424" loc="O"/>
		</Prediction>
		<Prediction name="Pro">
			<Region from="1" to="43" loc="I"/>
			<Region from="44" to="64" loc="M"/>
			<Region from="65" to="424" loc="O"/>
		</Prediction>
		<Prediction name="Prodiv">
			<Region from="1" to="217" loc="I"/>
			<Region from="218" to="238" loc="M"/>
			<Region from="239" to="259" loc="O"/>
			<Region from="260" to="280" loc="M"/>
			<Region from="281" to="300" loc="I"/>
			<Region from="301" to="321" loc="M"/>
			<Region from="322" to="341" loc="O"/>
			<Region from="342" to="362" loc="M"/>
			<Region from="363" to="382" loc="I"/>
			<Region from="383" to="403" loc="M"/>
			<Region from="404" to="424" loc="O"/>
		</Prediction>
		<Prediction name="Scampi">
			<Region from="1" to="47" loc="I"/>
			<Region from="48" to="68" loc="M"/>
			<Region from="69" to="424" loc="O"/>
		</Prediction>
		<Prediction name="ScampiMsa">
			<Region from="1" to="44" loc="I"/>
			<Region from="45" to="64" loc="M"/>
			<Region from="65" to="424" loc="O"/>
		</Prediction>
		<Prediction name="TMHMM">
			<Region from="1" to="42" loc="I"/>
			<Region from="43" to="65" loc="M"/>
			<Region from="66" to="424" loc="O"/>
		</Prediction>
	</Predictions>
</CCTOPItem>
