<?xml version="1.0"?>
<CCTOPItem id="Q9VE50" transmembrane="yes" evidence="TOPDOM">
	<Copyright>Copyrighted by the Institute of Enzymology!</Copyright>
	<Name>Golgi SNAP receptor complex member 1</Name>
	<CrossRef>
		<UniProt id="GOSR1_DROME">
			<AC>Q9VE50</AC>
			<AC>Q8SWZ4</AC>
		</UniProt>
		<TOPDOM id="PF12352"/>
	</CrossRef>
	<Sequence length="232" checkSum="7215b40dc5274418fc56a1441bcd938a">
		<Seq>MGGSSYDVLRKQARSLENEIDLKLVAFSKIGAGSGGGGSGGLGGVDTSPL
LGEHVFDSLSEEIEQMLEKLSSLNESMSDLPASGAAAMHTLQRHREILQG
YRQEFNKICANHTMRIEREELLRGSGLATSSGSPSISGLNRREMYLKESG
HLNSASHLVNDQINIAIETRDHLHAQRQAFKRLQTRFNDISNRFPLISSL
IQRINIKKRRDSLILGAVIGFCVILLLLYAFN</Seq>
	</Sequence>
	<Topology numTM="1" reliability="99.0237">
		<Region from="1" to="212" loc="I"/>
		<Region from="213" to="231" loc="M"/>
		<Region from="232" to="232" loc="O"/>
	</Topology>
	<Predictions>
		<Prediction name="HMMTOP">
			<Region from="1" to="212" loc="I"/>
			<Region from="213" to="231" loc="M"/>
			<Region from="232" to="232" loc="O"/>
		</Prediction>
		<Prediction name="Memsat">
			<Region from="1" to="212" loc="I"/>
			<Region from="213" to="229" loc="M"/>
			<Region from="230" to="232" loc="O"/>
		</Prediction>
		<Prediction name="Octopus">
			<Region from="1" to="210" loc="I"/>
			<Region from="211" to="231" loc="M"/>
			<Region from="232" to="232" loc="O"/>
		</Prediction>
		<Prediction name="Philius">
			<Region from="1" to="211" loc="I"/>
			<Region from="212" to="231" loc="M"/>
			<Region from="232" to="232" loc="O"/>
		</Prediction>
		<Prediction name="Phobius">
			<Region from="1" to="212" loc="I"/>
			<Region from="213" to="231" loc="M"/>
			<Region from="232" to="232" loc="O"/>
		</Prediction>
		<Prediction name="Pro">
			<Region from="1" to="210" loc="I"/>
			<Region from="211" to="231" loc="M"/>
			<Region from="232" to="232" loc="O"/>
		</Prediction>
		<Prediction name="Prodiv">
			<Region from="1" to="210" loc="I"/>
			<Region from="211" to="230" loc="M"/>
			<Region from="231" to="232" loc="O"/>
		</Prediction>
		<Prediction name="Scampi">
			<Region from="1" to="210" loc="I"/>
			<Region from="211" to="231" loc="M"/>
			<Region from="232" to="232" loc="O"/>
		</Prediction>
		<Prediction name="ScampiMsa">
			<Region from="1" to="210" loc="I"/>
			<Region from="211" to="230" loc="M"/>
			<Region from="231" to="232" loc="O"/>
		</Prediction>
		<Prediction name="TMHMM">
			<Region from="1" to="211" loc="I"/>
			<Region from="212" to="231" loc="M"/>
			<Region from="232" to="232" loc="O"/>
		</Prediction>
	</Predictions>
	<Constraints>
		<Constraint source="TOPDOM" sourceId="PF12352">
			<ConstraintRegion from="143" to="208" loc="I"/>
		</Constraint>
	</Constraints>
</CCTOPItem>
