<?xml version="1.0"?>
<CCTOPItem id="A0A0K0DS00" transmembrane="yes" evidence="Prediction">
	<Copyright>Copyrighted by the Institute of Enzymology!</Copyright>
	<Sequence length="397" checkSum="77b7bc56ec6e077c36023412dd5f54a2">
		<Seq>MLLEKAIKDFSDWNGVNVVTQAYYSKNKKILTLWILFIISMNLFALYSIL
KIYTNKNVAIKMRTTRETLRDEFPYVTICFDIVFNYNKFDNYDIEKNNPQ
SSYDNYFSSAIKHSSFRDSKLIGKNFGLSLFVSNKISEIDRHYQKALGYN
SVLAIYYSLYNNKDARDFGFHKNIIPLGYETNLSIVISKEIRNSDISECY
NYNEQSGKNYFDENSNSFETCYMNCLRDKEINECPAITPFNPNKCLDYDC
TCKTNECLNCSSNLIFPERKESKLVHPEFIKSCSCKYPCNYYIYKTSPSY
AKLHTKNMIKKFNLKGNYDDLKVDIEANYAIVNLFIKEKEIVIKQQVVIG
STANIFSDIGNTLSLLLGLGMINFIEIFFCIFVVCFSTIIVYAKKCI</Seq>
	</Sequence>
	<Topology numTM="2" reliability="89.9531">
		<Region from="1" to="29" loc="I"/>
		<Region from="30" to="50" loc="M"/>
		<Region from="51" to="365" loc="O"/>
		<Region from="366" to="393" loc="M"/>
		<Region from="394" to="397" loc="I"/>
	</Topology>
	<Predictions>
		<Prediction name="HMMTOP">
			<Region from="1" to="29" loc="I"/>
			<Region from="30" to="50" loc="M"/>
			<Region from="51" to="365" loc="O"/>
			<Region from="366" to="393" loc="M"/>
			<Region from="394" to="397" loc="I"/>
		</Prediction>
		<Prediction name="Memsat">
			<Region from="1" to="33" loc="O"/>
			<Region from="34" to="50" loc="M"/>
			<Region from="51" to="361" loc="I"/>
			<Region from="362" to="392" loc="M"/>
			<Region from="393" to="397" loc="O"/>
		</Prediction>
		<Prediction name="Octopus">
			<Region from="1" to="29" loc="I"/>
			<Region from="30" to="50" loc="M"/>
			<Region from="51" to="365" loc="O"/>
			<Region from="366" to="396" loc="M"/>
			<Region from="397" to="397" loc="I"/>
		</Prediction>
		<Prediction name="Philius">
			<Region from="1" to="29" loc="I"/>
			<Region from="30" to="50" loc="M"/>
			<Region from="51" to="368" loc="O"/>
			<Region from="369" to="392" loc="M"/>
			<Region from="393" to="397" loc="I"/>
		</Prediction>
		<Prediction name="Phobius">
			<Region from="1" to="29" loc="I"/>
			<Region from="30" to="50" loc="M"/>
			<Region from="51" to="364" loc="O"/>
			<Region from="365" to="393" loc="M"/>
			<Region from="394" to="397" loc="I"/>
		</Prediction>
		<Prediction name="Pro">
			<Region from="1" to="29" loc="I"/>
			<Region from="30" to="50" loc="M"/>
			<Region from="51" to="370" loc="O"/>
			<Region from="371" to="391" loc="M"/>
			<Region from="392" to="397" loc="I"/>
		</Prediction>
		<Prediction name="Prodiv">
			<Region from="1" to="29" loc="I"/>
			<Region from="30" to="50" loc="M"/>
			<Region from="51" to="363" loc="O"/>
			<Region from="364" to="392" loc="M"/>
			<Region from="393" to="397" loc="I"/>
		</Prediction>
		<Prediction name="Scampi">
			<Region from="1" to="29" loc="I"/>
			<Region from="30" to="50" loc="M"/>
			<Region from="51" to="372" loc="O"/>
			<Region from="373" to="393" loc="M"/>
			<Region from="394" to="397" loc="I"/>
		</Prediction>
		<Prediction name="ScampiMsa">
			<Region from="1" to="29" loc="I"/>
			<Region from="30" to="49" loc="M"/>
			<Region from="50" to="364" loc="O"/>
			<Region from="365" to="384" loc="M"/>
			<Region from="385" to="397" loc="I"/>
		</Prediction>
		<Prediction name="TMHMM">
			<Region from="1" to="29" loc="I"/>
			<Region from="30" to="52" loc="M"/>
			<Region from="53" to="370" loc="O"/>
			<Region from="371" to="393" loc="M"/>
			<Region from="394" to="397" loc="I"/>
		</Prediction>
	</Predictions>
</CCTOPItem>
