<?xml version="1.0"?>
<CCTOPItem id="A0A077YV23" transmembrane="yes" evidence="Prediction">
	<Copyright>Copyrighted by the Institute of Enzymology!</Copyright>
	<CrossRef>
		<Signal id="SignalP">
			<Results>1-24</Results>
			<Parameters>0.999459</Parameters>
		</Signal>
	</CrossRef>
	<Sequence length="323" checkSum="7a226f7ed7dae1a1be5b0a793ebb83ed">
		<Signal from="1" to="24"/>
		<Seq>MSLSKYALCAAVFCTLAFTLSVCETCPWHLKTDLQGWYDKGKGLCFTWHG
FVDTRFKSYIDSAIVCNSMYNGRMHAFRTQETRQTKNKHEFNIPSEIYKI
VETDRPKFYSGMRVVAVLDIKNTTTKKTMTLLLRDAYYNDTQLSVISMDQ
DWVPQNAFGLSKTHFQNLFDSNYNLPACLLMGPDANTFKLADVDACDSHV
DQVLCETAELKGCIKTGVKDKDGWLQCNCLPNYFGRFCQFYEKPKEKEDK
EQQMLVNIMLIGFGSFLFLFCCFAILIRRRLIRKRKRRHERMKKLAEKKH
AYKGLDVLESITSQMSTMFGKHK</Seq>
	</Sequence>
	<Topology numTM="1" reliability="98.6711">
		<Region from="1" to="24" loc="S"/>
		<Region from="25" to="257" loc="O"/>
		<Region from="258" to="277" loc="M"/>
		<Region from="278" to="323" loc="I"/>
	</Topology>
	<Predictions>
		<Prediction name="HMMTOP">
			<Region from="25" to="254" loc="O"/>
			<Region from="255" to="277" loc="M"/>
			<Region from="278" to="323" loc="I"/>
		</Prediction>
		<Prediction name="Memsat">
			<Region from="25" to="257" loc="O"/>
			<Region from="258" to="276" loc="M"/>
			<Region from="277" to="323" loc="I"/>
		</Prediction>
		<Prediction name="Octopus">
			<Region from="25" to="256" loc="O"/>
			<Region from="257" to="277" loc="M"/>
			<Region from="278" to="323" loc="I"/>
		</Prediction>
		<Prediction name="Philius">
			<Region from="25" to="257" loc="O"/>
			<Region from="258" to="277" loc="M"/>
			<Region from="278" to="323" loc="I"/>
		</Prediction>
		<Prediction name="Phobius">
			<Region from="25" to="253" loc="O"/>
			<Region from="254" to="277" loc="M"/>
			<Region from="278" to="323" loc="I"/>
		</Prediction>
		<Prediction name="Pro">
			<Region from="25" to="257" loc="O"/>
			<Region from="258" to="278" loc="M"/>
			<Region from="279" to="323" loc="I"/>
		</Prediction>
		<Prediction name="Prodiv">
			<Region from="25" to="257" loc="O"/>
			<Region from="258" to="279" loc="M"/>
			<Region from="280" to="323" loc="I"/>
		</Prediction>
		<Prediction name="Scampi">
			<Region from="25" to="261" loc="O"/>
			<Region from="262" to="282" loc="M"/>
			<Region from="283" to="323" loc="I"/>
		</Prediction>
		<Prediction name="ScampiMsa">
			<Region from="25" to="261" loc="O"/>
			<Region from="262" to="281" loc="M"/>
			<Region from="282" to="323" loc="I"/>
		</Prediction>
		<Prediction name="TMHMM">
			<Region from="25" to="254" loc="O"/>
			<Region from="255" to="277" loc="M"/>
			<Region from="278" to="323" loc="I"/>
		</Prediction>
	</Predictions>
	<Constraints>
		<Constraint source="SIGNAL" sourceId="SignalP">
			<ConstraintRegion from="25" to="25" loc="O"/>
		</Constraint>
	</Constraints>
</CCTOPItem>
