<?xml version="1.0"?>
<CCTOPItem id="A0A077YV64" transmembrane="yes" evidence="Prediction">
	<Copyright>Copyrighted by the Institute of Enzymology!</Copyright>
	<Sequence length="225" checkSum="7ae9a0a9c72319315c05126238436bd4">
		<Seq>MICMLGFCVVNVIHSLQLFIHRHHFDIHSPLVMLITGTVDVGVKMFAAAF
LDFSSATSKRMLVCRFSFYLSPSATVLTIATLRLMDHKQLVAWLDPFAAI
CTCATVAITSTLATTNYLTVLLMAVPKQFALAEICSQFEANENLHHVRVW
ADGNHILNLSAHVRFRCFKSYAERFESIKAFLTAHGATRVFLQPEFEKDE
GAPNGDCLFRADKFLQLHDGRPVEA</Seq>
	</Sequence>
	<Topology numTM="4" reliability="68.6431">
		<Region from="1" to="1" loc="I"/>
		<Region from="2" to="20" loc="M"/>
		<Region from="21" to="30" loc="O"/>
		<Region from="31" to="51" loc="M"/>
		<Region from="52" to="65" loc="I"/>
		<Region from="66" to="84" loc="M"/>
		<Region from="85" to="98" loc="O"/>
		<Region from="99" to="119" loc="M"/>
		<Region from="120" to="225" loc="I"/>
	</Topology>
	<Predictions>
		<Prediction name="HMMTOP">
			<Region from="1" to="1" loc="I"/>
			<Region from="2" to="20" loc="M"/>
			<Region from="21" to="30" loc="O"/>
			<Region from="31" to="58" loc="M"/>
			<Region from="59" to="70" loc="I"/>
			<Region from="71" to="81" loc="L"/>
			<Region from="82" to="97" loc="I"/>
			<Region from="98" to="125" loc="M"/>
			<Region from="126" to="225" loc="O"/>
		</Prediction>
		<Prediction name="Memsat">
			<Region from="1" to="30" loc="O"/>
			<Region from="31" to="48" loc="M"/>
			<Region from="49" to="90" loc="I"/>
			<Region from="91" to="121" loc="M"/>
			<Region from="122" to="225" loc="O"/>
		</Prediction>
		<Prediction name="Octopus">
			<Region from="1" to="1" loc="I"/>
			<Region from="2" to="22" loc="M"/>
			<Region from="23" to="28" loc="O"/>
			<Region from="29" to="49" loc="M"/>
			<Region from="50" to="72" loc="I"/>
			<Region from="73" to="77" loc="L"/>
			<Region from="78" to="95" loc="I"/>
			<Region from="96" to="116" loc="M"/>
			<Region from="117" to="225" loc="O"/>
		</Prediction>
		<Prediction name="Philius">
			<Region from="1" to="30" loc="O"/>
			<Region from="31" to="51" loc="M"/>
			<Region from="52" to="61" loc="I"/>
			<Region from="62" to="84" loc="M"/>
			<Region from="85" to="95" loc="O"/>
			<Region from="96" to="118" loc="M"/>
			<Region from="119" to="225" loc="I"/>
		</Prediction>
		<Prediction name="Phobius">
			<Region from="1" to="15" loc="S"/>
			<Region from="16" to="30" loc="O"/>
			<Region from="31" to="54" loc="M"/>
			<Region from="55" to="65" loc="I"/>
			<Region from="66" to="85" loc="M"/>
			<Region from="86" to="96" loc="O"/>
			<Region from="97" to="118" loc="M"/>
			<Region from="119" to="225" loc="I"/>
		</Prediction>
		<Prediction name="Pro">
			<Region from="1" to="1" loc="I"/>
			<Region from="2" to="22" loc="M"/>
			<Region from="23" to="26" loc="O"/>
			<Region from="27" to="47" loc="M"/>
			<Region from="48" to="62" loc="I"/>
			<Region from="63" to="83" loc="M"/>
			<Region from="84" to="99" loc="O"/>
			<Region from="100" to="120" loc="M"/>
			<Region from="121" to="225" loc="I"/>
		</Prediction>
		<Prediction name="Prodiv">
			<Region from="1" to="1" loc="I"/>
			<Region from="2" to="22" loc="M"/>
			<Region from="23" to="30" loc="O"/>
			<Region from="31" to="51" loc="M"/>
			<Region from="52" to="62" loc="I"/>
			<Region from="63" to="83" loc="M"/>
			<Region from="84" to="98" loc="O"/>
			<Region from="99" to="119" loc="M"/>
			<Region from="120" to="225" loc="I"/>
		</Prediction>
		<Prediction name="Scampi">
			<Region from="1" to="64" loc="I"/>
			<Region from="65" to="85" loc="M"/>
			<Region from="86" to="96" loc="O"/>
			<Region from="97" to="117" loc="M"/>
			<Region from="118" to="225" loc="I"/>
		</Prediction>
		<Prediction name="ScampiMsa">
			<Region from="1" to="65" loc="I"/>
			<Region from="66" to="85" loc="M"/>
			<Region from="86" to="89" loc="O"/>
			<Region from="90" to="109" loc="M"/>
			<Region from="110" to="225" loc="I"/>
		</Prediction>
		<Prediction name="TMHMM">
			<Region from="1" to="1" loc="I"/>
			<Region from="2" to="21" loc="M"/>
			<Region from="22" to="30" loc="O"/>
			<Region from="31" to="53" loc="M"/>
			<Region from="54" to="65" loc="I"/>
			<Region from="66" to="85" loc="M"/>
			<Region from="86" to="99" loc="O"/>
			<Region from="100" to="122" loc="M"/>
			<Region from="123" to="225" loc="I"/>
		</Prediction>
	</Predictions>
</CCTOPItem>
