<?xml version="1.0"?>
<CCTOPItem id="Q9Y140" transmembrane="yes" evidence="Prediction">
	<Copyright>Copyrighted by the Institute of Enzymology!</Copyright>
	<Name>Dehydrogenase/reductase SDR family protein 7-like</Name>
	<CrossRef>
		<UniProt id="DHRS7_DROME">
			<AC>Q9Y140</AC>
		</UniProt>
	</CrossRef>
	<Sequence length="326" checkSum="84cae6e512ae66f3450e49400ed4bf84">
		<Seq>MKVQDMDKCAPSSDWNVLYWVLGTVLMPVALPLAIINIWQRFQAQKFRNQ
LPGKVVLITGASSGLGESLAHVFYRAGCRVILAARRTQELERVKKDLLAL
DVDPAYPPTVLPLDLAELNSIPEFVTRVLAVYNQVDILINNGGISVRADV
ASTAVDVDLKVMVVNYFGSVALTKALLPSMVKRGSGHICFISSVQGKFAI
PQRAAYSASKHAMQAFADSLRAEVANKNINVSCVSPGYIRTQLSLNALTG
SGSSYGKVDETTAKGMSPDKLAERILQCILRKEPDIIVSDVQAKIAYYLR
HLCPSLYFWIMAKRAVKLENAEKKST</Seq>
	</Sequence>
	<Topology numTM="1" reliability="62.1655">
		<Region from="1" to="15" loc="I"/>
		<Region from="16" to="39" loc="M"/>
		<Region from="40" to="326" loc="O"/>
	</Topology>
	<Predictions>
		<Prediction name="HMMTOP">
			<Region from="1" to="14" loc="O"/>
			<Region from="15" to="42" loc="M"/>
			<Region from="43" to="54" loc="I"/>
			<Region from="55" to="82" loc="M"/>
			<Region from="83" to="326" loc="O"/>
		</Prediction>
		<Prediction name="Memsat">
			<Region from="1" to="23" loc="O"/>
			<Region from="24" to="40" loc="M"/>
			<Region from="41" to="162" loc="I"/>
			<Region from="163" to="178" loc="M"/>
			<Region from="179" to="295" loc="O"/>
			<Region from="296" to="312" loc="M"/>
			<Region from="313" to="326" loc="I"/>
		</Prediction>
		<Prediction name="Octopus">
			<Region from="1" to="17" loc="O"/>
			<Region from="18" to="38" loc="M"/>
			<Region from="39" to="52" loc="I"/>
			<Region from="53" to="73" loc="M"/>
			<Region from="74" to="326" loc="O"/>
		</Prediction>
		<Prediction name="Philius">
			<Region from="1" to="16" loc="I"/>
			<Region from="17" to="39" loc="M"/>
			<Region from="40" to="326" loc="O"/>
		</Prediction>
		<Prediction name="Phobius">
			<Region from="1" to="16" loc="O"/>
			<Region from="17" to="39" loc="M"/>
			<Region from="40" to="326" loc="I"/>
		</Prediction>
		<Prediction name="Pro">
			<Region from="1" to="16" loc="O"/>
			<Region from="17" to="37" loc="M"/>
			<Region from="38" to="326" loc="I"/>
		</Prediction>
		<Prediction name="Prodiv">
			<Region from="1" to="15" loc="I"/>
			<Region from="16" to="36" loc="M"/>
			<Region from="37" to="51" loc="O"/>
			<Region from="52" to="72" loc="M"/>
			<Region from="73" to="326" loc="I"/>
		</Prediction>
		<Prediction name="Scampi">
			<Region from="1" to="17" loc="I"/>
			<Region from="18" to="38" loc="M"/>
			<Region from="39" to="294" loc="O"/>
			<Region from="295" to="315" loc="M"/>
			<Region from="316" to="326" loc="I"/>
		</Prediction>
		<Prediction name="ScampiMsa">
			<Region from="1" to="17" loc="I"/>
			<Region from="18" to="37" loc="M"/>
			<Region from="38" to="294" loc="O"/>
			<Region from="295" to="314" loc="M"/>
			<Region from="315" to="326" loc="I"/>
		</Prediction>
		<Prediction name="TMHMM">
			<Region from="1" to="16" loc="I"/>
			<Region from="17" to="39" loc="M"/>
			<Region from="40" to="326" loc="O"/>
		</Prediction>
	</Predictions>
</CCTOPItem>
