<?xml version="1.0"?>
<CCTOPItem id="P50498" transmembrane="yes" evidence="Exists">
	<Copyright>Copyrighted by the Institute of Enzymology!</Copyright>
	<Name>Merozoite surface antigen 2</Name>
	<CrossRef>
		<UniProt id="MSA2_PLAF7">
			<AC>P50498</AC>
			<AC>Q9TY97</AC>
		</UniProt>
	</CrossRef>
	<Sequence length="272" checkSum="8ccd400c02ba0162033520ee954522d7">
		<Seq>MKVIKTLSIINFFIFVTFNIKNESKYSNTFINNAYNMSIRRSMAESKPST
GAGGSAGGSAGGSAGGSAGGSAGGSAGSGDGNGADAEGSSSTPATTTTTK
TTTTTTTTNDAEASTSTSSENPNHKNAETNPKGKGEVQEPNQANKETQNN
SNVQQDSQTKSNVPPTQDADTKSPTAQPEQAENSAPTAEQTESPELQSAP
ENKGTGQHGHMHGSRNNHPQNTSDSQKECTDGNKENCGAATSLLNNSSNI
ASINKFVVLISATLVLSFAIFI</Seq>
	</Sequence>
	<Topology numTM="2" reliability="55.331">
		<Region from="1" to="2" loc="O"/>
		<Region from="3" to="18" loc="M"/>
		<Region from="19" to="250" loc="I"/>
		<Region from="251" to="271" loc="M"/>
		<Region from="272" to="272" loc="O"/>
	</Topology>
	<Predictions>
		<Prediction name="HMMTOP">
			<Region from="1" to="2" loc="O"/>
			<Region from="3" to="18" loc="M"/>
			<Region from="19" to="255" loc="I"/>
			<Region from="256" to="271" loc="M"/>
			<Region from="272" to="272" loc="O"/>
		</Prediction>
		<Prediction name="Memsat">
			<Region from="1" to="252" loc="O"/>
			<Region from="253" to="269" loc="M"/>
			<Region from="270" to="272" loc="I"/>
		</Prediction>
		<Prediction name="Octopus">
			<Region from="1" to="250" loc="I"/>
			<Region from="251" to="271" loc="M"/>
			<Region from="272" to="272" loc="O"/>
		</Prediction>
		<Prediction name="Philius">
			<Region from="1" to="250" loc="O"/>
			<Region from="251" to="271" loc="M"/>
			<Region from="272" to="272" loc="I"/>
		</Prediction>
		<Prediction name="Phobius">
			<Region from="1" to="252" loc="O"/>
			<Region from="253" to="271" loc="M"/>
			<Region from="272" to="272" loc="I"/>
		</Prediction>
		<Prediction name="Pro">
			<Region from="1" to="249" loc="I"/>
			<Region from="250" to="270" loc="M"/>
			<Region from="271" to="272" loc="O"/>
		</Prediction>
		<Prediction name="Prodiv">
			<Region from="1" to="5" loc="I"/>
			<Region from="6" to="26" loc="M"/>
			<Region from="27" to="249" loc="O"/>
			<Region from="250" to="271" loc="M"/>
			<Region from="272" to="272" loc="I"/>
		</Prediction>
		<Prediction name="Scampi">
			<Region from="1" to="1" loc="I"/>
			<Region from="2" to="22" loc="M"/>
			<Region from="23" to="250" loc="O"/>
			<Region from="251" to="271" loc="M"/>
			<Region from="272" to="272" loc="I"/>
		</Prediction>
		<Prediction name="ScampiMsa">
			<Region from="1" to="1" loc="O"/>
			<Region from="2" to="21" loc="M"/>
			<Region from="22" to="250" loc="I"/>
			<Region from="251" to="270" loc="M"/>
			<Region from="271" to="272" loc="O"/>
		</Prediction>
	</Predictions>
</CCTOPItem>
