<?xml version="1.0"?>
<CCTOPItem id="D3ZLY0" transmembrane="yes" evidence="Prediction">
	<Copyright>Copyrighted by the Institute of Enzymology!</Copyright>
	<Name>ATP synthase subunit C lysine N-methyltransferase {ECO:0000305}</Name>
	<CrossRef>
		<UniProt id="ACKMT_RAT">
			<AC>D3ZLY0</AC>
		</UniProt>
	</CrossRef>
	<Sequence length="216" checkSum="8ea6807e632e6d803f82d5073640d3b0">
		<Seq>MERGETPEEERQSGCVLPTSPESDSLKTSNWGFLITGVIGGALVTVYAVT
TPFIAPALRKVCLPFVPATSRQVENVVKMLQHRRGPLVDIGSGDGRIVIA
AAKAGFPAVGYELNPWLVWYSRYRAWREGVHGSAKFYISDLWKVTFAQYS
NVVIFGVPQMMPQLEKKLEFELEDGARVIACRFPFPHWTPDHTTGEGIDT
VWAYDMSACRTQGKRA</Seq>
	</Sequence>
	<Topology numTM="1" reliability="73.8281">
		<Region from="1" to="30" loc="I"/>
		<Region from="31" to="52" loc="M"/>
		<Region from="53" to="216" loc="O"/>
	</Topology>
	<Predictions>
		<Prediction name="HMMTOP">
			<Region from="1" to="31" loc="I"/>
			<Region from="32" to="55" loc="M"/>
			<Region from="56" to="216" loc="O"/>
		</Prediction>
		<Prediction name="Memsat">
			<Region from="1" to="41" loc="O"/>
			<Region from="42" to="58" loc="M"/>
			<Region from="59" to="216" loc="I"/>
		</Prediction>
		<Prediction name="Octopus">
			<Region from="1" to="31" loc="I"/>
			<Region from="32" to="52" loc="M"/>
			<Region from="53" to="216" loc="O"/>
		</Prediction>
		<Prediction name="Philius">
			<Region from="1" to="30" loc="I"/>
			<Region from="31" to="55" loc="M"/>
			<Region from="56" to="216" loc="O"/>
		</Prediction>
		<Prediction name="Phobius">
			<Region from="1" to="30" loc="O"/>
			<Region from="31" to="50" loc="M"/>
			<Region from="51" to="216" loc="I"/>
		</Prediction>
		<Prediction name="Pro">
			<Region from="1" to="30" loc="I"/>
			<Region from="31" to="51" loc="M"/>
			<Region from="52" to="216" loc="O"/>
		</Prediction>
		<Prediction name="Prodiv">
			<Region from="1" to="30" loc="I"/>
			<Region from="31" to="51" loc="M"/>
			<Region from="52" to="97" loc="O"/>
			<Region from="98" to="118" loc="M"/>
			<Region from="119" to="216" loc="I"/>
		</Prediction>
		<Prediction name="Scampi">
			<Region from="1" to="30" loc="I"/>
			<Region from="31" to="51" loc="M"/>
			<Region from="52" to="216" loc="O"/>
		</Prediction>
		<Prediction name="ScampiMsa">
			<Region from="1" to="30" loc="I"/>
			<Region from="31" to="50" loc="M"/>
			<Region from="51" to="216" loc="O"/>
		</Prediction>
		<Prediction name="TMHMM">
			<Region from="1" to="32" loc="I"/>
			<Region from="33" to="55" loc="M"/>
			<Region from="56" to="216" loc="O"/>
		</Prediction>
	</Predictions>
</CCTOPItem>
