<?xml version="1.0"?>
<CCTOPItem id="A0A077YUV9" transmembrane="yes" evidence="Prediction">
	<Copyright>Copyrighted by the Institute of Enzymology!</Copyright>
	<Sequence length="98" checkSum="91e86901a4100203792dfadfdbe4537d">
		<Seq>MALPRICPICGPKCSLCCMVFGAWGTIFLAILGIMFYTQSVLLFEDIHYE
KEASEFSTSEISERYRSTAFNCWIATGGYVVTMIIAFWQTKWNNHLLL</Seq>
	</Sequence>
	<Topology numTM="2" reliability="87.8557">
		<Region from="1" to="15" loc="I"/>
		<Region from="16" to="36" loc="M"/>
		<Region from="37" to="67" loc="O"/>
		<Region from="68" to="88" loc="M"/>
		<Region from="89" to="98" loc="I"/>
	</Topology>
	<Predictions>
		<Prediction name="HMMTOP">
			<Region from="1" to="13" loc="I"/>
			<Region from="14" to="34" loc="M"/>
			<Region from="35" to="67" loc="O"/>
			<Region from="68" to="88" loc="M"/>
			<Region from="89" to="98" loc="I"/>
		</Prediction>
		<Prediction name="Memsat">
			<Region from="1" to="13" loc="I"/>
			<Region from="14" to="39" loc="M"/>
			<Region from="40" to="68" loc="O"/>
			<Region from="69" to="87" loc="M"/>
			<Region from="88" to="98" loc="I"/>
		</Prediction>
		<Prediction name="Octopus">
			<Region from="1" to="17" loc="I"/>
			<Region from="18" to="38" loc="M"/>
			<Region from="39" to="69" loc="O"/>
			<Region from="70" to="90" loc="M"/>
			<Region from="91" to="98" loc="I"/>
		</Prediction>
		<Prediction name="Philius">
			<Region from="1" to="13" loc="I"/>
			<Region from="14" to="37" loc="M"/>
			<Region from="38" to="68" loc="O"/>
			<Region from="69" to="90" loc="M"/>
			<Region from="91" to="98" loc="I"/>
		</Prediction>
		<Prediction name="Phobius">
			<Region from="1" to="20" loc="O"/>
			<Region from="21" to="44" loc="M"/>
			<Region from="45" to="64" loc="I"/>
			<Region from="65" to="88" loc="M"/>
			<Region from="89" to="98" loc="O"/>
		</Prediction>
		<Prediction name="Pro">
			<Region from="1" to="15" loc="I"/>
			<Region from="16" to="36" loc="M"/>
			<Region from="37" to="67" loc="O"/>
			<Region from="68" to="88" loc="M"/>
			<Region from="89" to="98" loc="I"/>
		</Prediction>
		<Prediction name="Prodiv">
			<Region from="1" to="15" loc="I"/>
			<Region from="16" to="36" loc="M"/>
			<Region from="37" to="69" loc="O"/>
			<Region from="70" to="90" loc="M"/>
			<Region from="91" to="98" loc="I"/>
		</Prediction>
		<Prediction name="Scampi">
			<Region from="1" to="15" loc="I"/>
			<Region from="16" to="36" loc="M"/>
			<Region from="37" to="71" loc="O"/>
			<Region from="72" to="92" loc="M"/>
			<Region from="93" to="98" loc="I"/>
		</Prediction>
		<Prediction name="ScampiMsa">
			<Region from="1" to="15" loc="I"/>
			<Region from="16" to="35" loc="M"/>
			<Region from="36" to="67" loc="O"/>
			<Region from="68" to="87" loc="M"/>
			<Region from="88" to="98" loc="I"/>
		</Prediction>
		<Prediction name="TMHMM">
			<Region from="1" to="19" loc="I"/>
			<Region from="20" to="42" loc="M"/>
			<Region from="43" to="65" loc="O"/>
			<Region from="66" to="88" loc="M"/>
			<Region from="89" to="98" loc="I"/>
		</Prediction>
	</Predictions>
</CCTOPItem>
