<?xml version="1.0"?>
<CCTOPItem id="A0A146MGE2" transmembrane="yes" evidence="Experiment">
	<Copyright>Copyrighted by the Institute of Enzymology!</Copyright>
	<CrossRef>
		<TOPDB id="AP03455">
			<Alignment>
				<CrossRefSeq>MTKLAQWLWGLAILGSTWVALTTGALGLELPLSCQEVLWP-LPAYLLVSAGCYALGTVGYRVATFHDCEDAARELQSQIQEARADLARRGLRF---</CrossRefSeq>
				<OrigSeq>MKKIVEWLLVLSLISAIWVSKLMGIITVQS--DCGNIILNWLPFHILFIFGTVSVLIILYRTYSFNDCPEASTELMKLVNEAKRDLTYRGFVFFES</OrigSeq>
			</Alignment>
		</TOPDB>
	</CrossRef>
	<Sequence length="93" checkSum="95fd68415550cb0e757a2a987a5c60ff">
		<Seq>MKKIVEWLLVLSLISAIWVSKLMGIITVQSDCGNIILNWLPFHILFIFGT
VSVLIILYRTYSFNDCPEASTELMKLVNEAKRDLTYRGFVFES</Seq>
	</Sequence>
	<Topology numTM="2" reliability="73.4798">
		<Region from="1" to="6" loc="O"/>
		<Region from="7" to="28" loc="M"/>
		<Region from="29" to="38" loc="I"/>
		<Region from="39" to="58" loc="M"/>
		<Region from="59" to="93" loc="O"/>
	</Topology>
	<Predictions>
		<Prediction name="HMMTOP">
			<Region from="1" to="6" loc="O"/>
			<Region from="7" to="28" loc="M"/>
			<Region from="29" to="34" loc="I"/>
			<Region from="35" to="56" loc="M"/>
			<Region from="57" to="93" loc="O"/>
		</Prediction>
		<Prediction name="Memsat">
			<Region from="1" to="21" loc="O"/>
			<Region from="22" to="37" loc="M"/>
			<Region from="38" to="40" loc="I"/>
			<Region from="41" to="58" loc="M"/>
			<Region from="59" to="93" loc="O"/>
		</Prediction>
		<Prediction name="Octopus">
			<Region from="1" to="5" loc="O"/>
			<Region from="6" to="26" loc="M"/>
			<Region from="27" to="39" loc="I"/>
			<Region from="40" to="60" loc="M"/>
			<Region from="61" to="93" loc="O"/>
		</Prediction>
		<Prediction name="Philius">
			<Region from="1" to="6" loc="I"/>
			<Region from="7" to="28" loc="M"/>
			<Region from="29" to="38" loc="O"/>
			<Region from="39" to="58" loc="M"/>
			<Region from="59" to="93" loc="I"/>
		</Prediction>
		<Prediction name="Phobius">
			<Region from="1" to="24" loc="S"/>
			<Region from="25" to="39" loc="O"/>
			<Region from="40" to="58" loc="M"/>
			<Region from="59" to="93" loc="I"/>
		</Prediction>
		<Prediction name="Pro">
			<Region from="1" to="9" loc="I"/>
			<Region from="10" to="30" loc="M"/>
			<Region from="31" to="34" loc="O"/>
			<Region from="35" to="55" loc="M"/>
			<Region from="56" to="93" loc="I"/>
		</Prediction>
		<Prediction name="Prodiv">
			<Region from="1" to="6" loc="I"/>
			<Region from="7" to="27" loc="M"/>
			<Region from="28" to="38" loc="O"/>
			<Region from="39" to="59" loc="M"/>
			<Region from="60" to="93" loc="I"/>
		</Prediction>
		<Prediction name="Scampi">
			<Region from="1" to="6" loc="I"/>
			<Region from="7" to="27" loc="M"/>
			<Region from="28" to="42" loc="O"/>
			<Region from="43" to="63" loc="M"/>
			<Region from="64" to="93" loc="I"/>
		</Prediction>
		<Prediction name="ScampiMsa">
			<Region from="1" to="3" loc="I"/>
			<Region from="4" to="23" loc="M"/>
			<Region from="24" to="38" loc="O"/>
			<Region from="39" to="58" loc="M"/>
			<Region from="59" to="93" loc="I"/>
		</Prediction>
		<Prediction name="TMHMM">
			<Region from="1" to="6" loc="I"/>
			<Region from="7" to="29" loc="M"/>
			<Region from="30" to="38" loc="O"/>
			<Region from="39" to="58" loc="M"/>
			<Region from="59" to="93" loc="I"/>
		</Prediction>
	</Predictions>
	<Constraints>
		<Constraint source="TOPDB" sourceId="AP03455">
			<ConstraintRegion from="62" to="62" loc="O" subId="00001" subSource="23584533"/>
		</Constraint>
	</Constraints>
</CCTOPItem>
