<?xml version="1.0"?>
<CCTOPItem id="Q27236" transmembrane="yes" evidence="Prediction">
	<Copyright>Copyrighted by the Institute of Enzymology!</Copyright>
	<Name>Synaptobrevin-like protein</Name>
	<CrossRef>
		<UniProt id="SYBL_SCHMA">
			<AC>Q27236</AC>
			<AC>Q26550</AC>
			<AC>Q27353</AC>
		</UniProt>
	</CrossRef>
	<Sequence length="131" checkSum="9833493f07e01e2f7cda7e769e37eb17">
		<Seq>MLHITTMTDKAPIKTNKRLQQTQAQVNEVVDIMRVNVDKVLERDKNLSEL
DGRADALQAGASQFEASAGKLKRKFWWKNCKMLAVLGVLVVILIIVLIVW
VVSEQKNKVEQSEHSSHHLVMDNSSHLLSEQ</Seq>
	</Sequence>
	<Topology numTM="1" reliability="99.2248">
		<Region from="1" to="81" loc="I"/>
		<Region from="82" to="102" loc="M"/>
		<Region from="103" to="131" loc="O"/>
	</Topology>
	<Predictions>
		<Prediction name="HMMTOP">
			<Region from="1" to="82" loc="I"/>
			<Region from="83" to="102" loc="M"/>
			<Region from="103" to="131" loc="O"/>
		</Prediction>
		<Prediction name="Memsat">
			<Region from="1" to="80" loc="I"/>
			<Region from="81" to="102" loc="M"/>
			<Region from="103" to="131" loc="O"/>
		</Prediction>
		<Prediction name="Octopus">
			<Region from="1" to="81" loc="I"/>
			<Region from="82" to="102" loc="M"/>
			<Region from="103" to="131" loc="O"/>
		</Prediction>
		<Prediction name="Philius">
			<Region from="1" to="81" loc="I"/>
			<Region from="82" to="102" loc="M"/>
			<Region from="103" to="131" loc="O"/>
		</Prediction>
		<Prediction name="Phobius">
			<Region from="1" to="81" loc="I"/>
			<Region from="82" to="102" loc="M"/>
			<Region from="103" to="131" loc="O"/>
		</Prediction>
		<Prediction name="Pro">
			<Region from="1" to="81" loc="I"/>
			<Region from="82" to="102" loc="M"/>
			<Region from="103" to="131" loc="O"/>
		</Prediction>
		<Prediction name="Prodiv">
			<Region from="1" to="81" loc="I"/>
			<Region from="82" to="102" loc="M"/>
			<Region from="103" to="131" loc="O"/>
		</Prediction>
		<Prediction name="Scampi">
			<Region from="1" to="81" loc="I"/>
			<Region from="82" to="102" loc="M"/>
			<Region from="103" to="131" loc="O"/>
		</Prediction>
		<Prediction name="ScampiMsa">
			<Region from="1" to="81" loc="I"/>
			<Region from="82" to="101" loc="M"/>
			<Region from="102" to="131" loc="O"/>
		</Prediction>
		<Prediction name="TMHMM">
			<Region from="1" to="82" loc="I"/>
			<Region from="83" to="102" loc="M"/>
			<Region from="103" to="131" loc="O"/>
		</Prediction>
	</Predictions>
</CCTOPItem>
