<?xml version="1.0"?>
<CCTOPItem id="Q9NYX4" transmembrane="yes" evidence="Exists">
	<Copyright>Copyrighted by the Institute of Enzymology!</Copyright>
	<Name>Neuron-specific vesicular protein calcyon</Name>
	<CrossRef>
		<UniProt id="CALY_HUMAN">
			<AC>Q9NYX4</AC>
			<AC>Q5VWX3</AC>
			<AC>Q5VWY5</AC>
			<AC>Q5VWY6</AC>
		</UniProt>
	</CrossRef>
	<Sequence length="217" checkSum="9bc06c7598b2ab8b0211b7ce8a8fc799">
		<Seq>MVKLGCSFSGKPGKDPGDQDGAAMDSVPLISPLDISQLQPPLPDQVVIKT
QTEYQLSSPDQQNFPDLEGQRLNCSHPEEGRRLPTARMIAFAMALLGCVL
IMYKAIWYDQFTCPDGFLLRHKICTPLTLEMYYTEMDPERHRSILAAIGA
YPLSRKHGTETPAAWGDGYRAAKEERKGPTQAGAAAAATEPPGKPSAKAE
KEAARKAAGSAAPPPAQ</Seq>
	</Sequence>
	<Topology numTM="1" reliability="85.8324">
		<Region from="1" to="87" loc="I"/>
		<Region from="88" to="107" loc="M"/>
		<Region from="108" to="217" loc="O"/>
	</Topology>
	<Predictions>
		<Prediction name="HMMTOP">
			<Region from="1" to="84" loc="O"/>
			<Region from="85" to="102" loc="M"/>
			<Region from="103" to="217" loc="I"/>
		</Prediction>
		<Prediction name="Memsat">
			<Region from="1" to="85" loc="I"/>
			<Region from="86" to="106" loc="M"/>
			<Region from="107" to="217" loc="O"/>
		</Prediction>
		<Prediction name="Octopus">
			<Region from="1" to="84" loc="I"/>
			<Region from="85" to="105" loc="M"/>
			<Region from="106" to="217" loc="O"/>
		</Prediction>
		<Prediction name="Philius">
			<Region from="1" to="87" loc="I"/>
			<Region from="88" to="107" loc="M"/>
			<Region from="108" to="217" loc="O"/>
		</Prediction>
		<Prediction name="Phobius">
			<Region from="1" to="87" loc="I"/>
			<Region from="88" to="108" loc="M"/>
			<Region from="109" to="217" loc="O"/>
		</Prediction>
		<Prediction name="Pro">
			<Region from="1" to="87" loc="I"/>
			<Region from="88" to="108" loc="M"/>
			<Region from="109" to="217" loc="O"/>
		</Prediction>
		<Prediction name="Prodiv">
			<Region from="1" to="87" loc="I"/>
			<Region from="88" to="108" loc="M"/>
			<Region from="109" to="217" loc="O"/>
		</Prediction>
		<Prediction name="Scampi">
			<Region from="1" to="87" loc="I"/>
			<Region from="88" to="108" loc="M"/>
			<Region from="109" to="217" loc="O"/>
		</Prediction>
		<Prediction name="ScampiMsa">
			<Region from="1" to="87" loc="I"/>
			<Region from="88" to="107" loc="M"/>
			<Region from="108" to="217" loc="O"/>
		</Prediction>
		<Prediction name="TMHMM">
			<Region from="1" to="88" loc="I"/>
			<Region from="89" to="111" loc="M"/>
			<Region from="112" to="217" loc="O"/>
		</Prediction>
	</Predictions>
</CCTOPItem>
