<?xml version="1.0"?>
<CCTOPItem id="O95424" transmembrane="yes" evidence="Exists">
	<Copyright>Copyrighted by the Institute of Enzymology!</Copyright>
	<Name>Dexamethasone-induced protein</Name>
	<CrossRef>
		<UniProt id="DEXI_HUMAN">
			<AC>O95424</AC>
			<AC>B2RAA7</AC>
		</UniProt>
	</CrossRef>
	<Sequence length="95" checkSum="9caaf553b1a76cb1cc73d98bc1b21560">
		<Seq>MLGARVAAHLDALGPLVPYVPPPLLPSMFYVGLFFVNVLILYYAFLMEYI
VLNVGLVFLPEDMDQALVDLGVLSDPGSGLYDADSELDVFDAYLE</Seq>
	</Sequence>
	<Topology numTM="1" reliability="63.2728">
		<Region from="1" to="28" loc="I"/>
		<Region from="29" to="52" loc="M"/>
		<Region from="53" to="95" loc="O"/>
	</Topology>
	<Predictions>
		<Prediction name="HMMTOP">
			<Region from="1" to="30" loc="I"/>
			<Region from="31" to="58" loc="M"/>
			<Region from="59" to="95" loc="O"/>
		</Prediction>
		<Prediction name="Memsat">
			<Region from="1" to="27" loc="I"/>
			<Region from="28" to="58" loc="M"/>
			<Region from="59" to="95" loc="O"/>
		</Prediction>
		<Prediction name="Octopus">
			<Region from="1" to="30" loc="I"/>
			<Region from="31" to="51" loc="M"/>
			<Region from="52" to="95" loc="O"/>
		</Prediction>
		<Prediction name="Philius">
			<Region from="1" to="23" loc="O"/>
			<Region from="24" to="46" loc="M"/>
			<Region from="47" to="95" loc="I"/>
		</Prediction>
		<Prediction name="Phobius">
			<Region from="1" to="26" loc="O"/>
			<Region from="27" to="46" loc="M"/>
			<Region from="47" to="95" loc="I"/>
		</Prediction>
		<Prediction name="Pro">
			<Region from="1" to="26" loc="I"/>
			<Region from="27" to="47" loc="M"/>
			<Region from="48" to="95" loc="O"/>
		</Prediction>
		<Prediction name="Prodiv">
			<Region from="1" to="14" loc="I"/>
			<Region from="15" to="35" loc="M"/>
			<Region from="36" to="39" loc="O"/>
			<Region from="40" to="60" loc="M"/>
			<Region from="61" to="95" loc="I"/>
		</Prediction>
		<Prediction name="Scampi">
			<Region from="1" to="26" loc="I"/>
			<Region from="27" to="47" loc="M"/>
			<Region from="48" to="95" loc="O"/>
		</Prediction>
		<Prediction name="ScampiMsa">
			<Region from="1" to="26" loc="I"/>
			<Region from="27" to="46" loc="M"/>
			<Region from="47" to="95" loc="O"/>
		</Prediction>
		<Prediction name="TMHMM">
			<Region from="1" to="23" loc="O"/>
			<Region from="24" to="46" loc="M"/>
			<Region from="47" to="95" loc="I"/>
		</Prediction>
	</Predictions>
</CCTOPItem>
