<?xml version="1.0"?>
<CCTOPItem id="A0A0U5KEW2" transmembrane="yes" evidence="Prediction">
	<Copyright>Copyrighted by the Institute of Enzymology!</Copyright>
	<Sequence length="78" checkSum="a3f0d76f3f7e7126fb7d67ce8053c841">
		<Seq>MYYRHYLLAIINVIVLSTMIQYVIGGSIFGDDTSTTKNMTTTTKASSANS
LEVSWLAISSISMIVIGLINGHLRRFIF</Seq>
	</Sequence>
	<Topology numTM="2" reliability="86.5802">
		<Region from="1" to="6" loc="I"/>
		<Region from="7" to="25" loc="M"/>
		<Region from="26" to="52" loc="O"/>
		<Region from="53" to="71" loc="M"/>
		<Region from="72" to="78" loc="I"/>
	</Topology>
	<Predictions>
		<Prediction name="HMMTOP">
			<Region from="1" to="6" loc="I"/>
			<Region from="7" to="24" loc="M"/>
			<Region from="25" to="52" loc="O"/>
			<Region from="53" to="69" loc="M"/>
			<Region from="70" to="78" loc="I"/>
		</Prediction>
		<Prediction name="Memsat">
			<Region from="1" to="13" loc="O"/>
			<Region from="14" to="29" loc="M"/>
			<Region from="30" to="53" loc="I"/>
			<Region from="54" to="71" loc="M"/>
			<Region from="72" to="78" loc="O"/>
		</Prediction>
		<Prediction name="Octopus">
			<Region from="1" to="4" loc="I"/>
			<Region from="5" to="25" loc="M"/>
			<Region from="26" to="52" loc="O"/>
			<Region from="53" to="73" loc="M"/>
			<Region from="74" to="78" loc="I"/>
		</Prediction>
		<Prediction name="Philius">
			<Region from="1" to="6" loc="I"/>
			<Region from="7" to="29" loc="M"/>
			<Region from="30" to="52" loc="O"/>
			<Region from="53" to="73" loc="M"/>
			<Region from="74" to="78" loc="I"/>
		</Prediction>
		<Prediction name="Phobius">
			<Region from="1" to="6" loc="I"/>
			<Region from="7" to="29" loc="M"/>
			<Region from="30" to="52" loc="O"/>
			<Region from="53" to="73" loc="M"/>
			<Region from="74" to="78" loc="I"/>
		</Prediction>
		<Prediction name="Pro">
			<Region from="1" to="9" loc="I"/>
			<Region from="10" to="30" loc="M"/>
			<Region from="31" to="50" loc="O"/>
			<Region from="51" to="71" loc="M"/>
			<Region from="72" to="78" loc="I"/>
		</Prediction>
		<Prediction name="Prodiv">
			<Region from="1" to="9" loc="I"/>
			<Region from="10" to="30" loc="M"/>
			<Region from="31" to="50" loc="O"/>
			<Region from="51" to="71" loc="M"/>
			<Region from="72" to="78" loc="I"/>
		</Prediction>
		<Prediction name="Scampi">
			<Region from="1" to="4" loc="I"/>
			<Region from="5" to="25" loc="M"/>
			<Region from="26" to="52" loc="O"/>
			<Region from="53" to="73" loc="M"/>
			<Region from="74" to="78" loc="I"/>
		</Prediction>
		<Prediction name="ScampiMsa">
			<Region from="1" to="4" loc="I"/>
			<Region from="5" to="24" loc="M"/>
			<Region from="25" to="52" loc="O"/>
			<Region from="53" to="72" loc="M"/>
			<Region from="73" to="78" loc="I"/>
		</Prediction>
		<Prediction name="TMHMM">
			<Region from="1" to="6" loc="I"/>
			<Region from="7" to="29" loc="M"/>
			<Region from="30" to="50" loc="O"/>
			<Region from="51" to="73" loc="M"/>
			<Region from="74" to="78" loc="I"/>
		</Prediction>
	</Predictions>
</CCTOPItem>
