<?xml version="1.0"?>
<CCTOPItem id="P09383" transmembrane="yes" evidence="TOPDOM">
	<Copyright>Copyrighted by the Institute of Enzymology!</Copyright>
	<Name>Hypoxanthine-guanine phosphoribosyltransferase</Name>
	<CrossRef>
		<UniProt id="HPRT_SCHMA">
			<AC>P09383</AC>
		</UniProt>
		<TOPDOM id="PF00156"/>
		<TOPDOM id="PS00103"/>
	</CrossRef>
	<Sequence length="284" checkSum="aa267a2cfa5eaa761a575b094c3b9675">
		<Seq>MLTSLITSSTTVTLTLSQIYYILDIACGFLISVLVWMNSSVLDNGNHSNP
QIRDMSSNMIKADCVVIEDSFRGFPTEYFCTSPRYDECLDYVLIPNGMIK
DRLEKMSMDIVDYYEACNATSITLMCVLKGGFKFLADLVDGLERTVRARG
IVLPMSVEFVRVKSYVNDVSIHEPILTGLGDPSEYKDKNVLVVEDIIDTG
KTITKLISHLDSLSTKSVKVASLLVKRTSPRNDYRPDVGFEVPNRFVVGY
ALDYNDNFRDLHHICVINEVGQKKFSVPCTSKPV</Seq>
	</Sequence>
	<Topology numTM="1" reliability="77.6007">
		<Region from="1" to="18" loc="O"/>
		<Region from="19" to="37" loc="M"/>
		<Region from="38" to="284" loc="I"/>
	</Topology>
	<Predictions>
		<Prediction name="HMMTOP">
			<Region from="1" to="11" loc="O"/>
			<Region from="12" to="36" loc="M"/>
			<Region from="37" to="284" loc="I"/>
		</Prediction>
		<Prediction name="Memsat">
			<Region from="1" to="16" loc="O"/>
			<Region from="17" to="35" loc="M"/>
			<Region from="36" to="122" loc="I"/>
			<Region from="123" to="138" loc="M"/>
			<Region from="139" to="284" loc="O"/>
		</Prediction>
		<Prediction name="Octopus">
			<Region from="1" to="18" loc="O"/>
			<Region from="19" to="39" loc="M"/>
			<Region from="40" to="120" loc="I"/>
			<Region from="121" to="141" loc="M"/>
			<Region from="142" to="284" loc="O"/>
		</Prediction>
		<Prediction name="Philius">
			<Region from="1" to="18" loc="I"/>
			<Region from="19" to="37" loc="M"/>
			<Region from="38" to="284" loc="O"/>
		</Prediction>
		<Prediction name="Phobius">
			<Region from="1" to="18" loc="O"/>
			<Region from="19" to="37" loc="M"/>
			<Region from="38" to="284" loc="I"/>
		</Prediction>
		<Prediction name="Pro">
			<Region from="1" to="20" loc="I"/>
			<Region from="21" to="41" loc="M"/>
			<Region from="42" to="284" loc="O"/>
		</Prediction>
		<Prediction name="Prodiv">
			<Region from="1" to="18" loc="I"/>
			<Region from="19" to="36" loc="M"/>
			<Region from="37" to="121" loc="O"/>
			<Region from="122" to="142" loc="M"/>
			<Region from="143" to="284" loc="I"/>
		</Prediction>
		<Prediction name="Scampi">
			<Region from="1" to="18" loc="I"/>
			<Region from="19" to="39" loc="M"/>
			<Region from="40" to="284" loc="O"/>
		</Prediction>
		<Prediction name="ScampiMsa">
			<Region from="1" to="18" loc="I"/>
			<Region from="19" to="38" loc="M"/>
			<Region from="39" to="118" loc="O"/>
			<Region from="119" to="138" loc="M"/>
			<Region from="139" to="284" loc="I"/>
		</Prediction>
		<Prediction name="TMHMM">
			<Region from="1" to="19" loc="O"/>
			<Region from="20" to="42" loc="M"/>
			<Region from="43" to="284" loc="I"/>
		</Prediction>
	</Predictions>
	<Constraints>
		<Constraint source="TOPDOM" sourceId="PF00156">
			<ConstraintRegion from="99" to="254" loc="I"/>
		</Constraint>
		<Constraint source="TOPDOM" sourceId="PS00103">
			<ConstraintRegion from="190" to="202" loc="I"/>
		</Constraint>
	</Constraints>
</CCTOPItem>
