<?xml version="1.0"?>
<CCTOPItem id="Q17704" transmembrane="yes" evidence="Prediction">
	<Copyright>Copyrighted by the Institute of Enzymology!</Copyright>
	<Name>Putative steroid dehydrogenase 3</Name>
	<CrossRef>
		<UniProt id="STDH3_CAEEL">
			<AC>Q17704</AC>
		</UniProt>
	</CrossRef>
	<Sequence length="315" checkSum="b6c26efe788f84d4e34ddc52d1519f8c">
		<Seq>MNIEWFAIGVGAIVVLYILYHFIKMIWSILGLYVFYQPIDLKKKAGASWA
VITGGTDGIGKSFSFELAKRGFNIYIVSRTQSKLEQTKKEIMEKYSNVEV
RFATFDFTNPSISDYKKLLSQLNEVSIGMLINNVGMLFEYPENLHKTVGG
IDVVANVTILNTLPVTLLSAGILPQMVSRKTGIIVNIGSVAGAAKMAEWS
VYSASKKYVEWLTGCLRKEYEHQGIIIQAITPALVATKLSGHTETSLFCP
DSATFAKSALNTVGHTSQTTGYINHQIQCEMLALFPECFLDSFVKKSSVE
TREKALAKKENKHLL</Seq>
	</Sequence>
	<Topology numTM="1" reliability="56.5556">
		<Region from="1" to="7" loc="O"/>
		<Region from="8" to="35" loc="M"/>
		<Region from="36" to="315" loc="I"/>
	</Topology>
	<Predictions>
		<Prediction name="HMMTOP">
			<Region from="1" to="5" loc="O"/>
			<Region from="6" to="26" loc="M"/>
			<Region from="27" to="28" loc="I"/>
			<Region from="29" to="56" loc="M"/>
			<Region from="57" to="156" loc="O"/>
			<Region from="157" to="177" loc="M"/>
			<Region from="178" to="181" loc="I"/>
			<Region from="182" to="202" loc="M"/>
			<Region from="203" to="272" loc="O"/>
			<Region from="273" to="294" loc="M"/>
			<Region from="295" to="315" loc="I"/>
		</Prediction>
		<Prediction name="Memsat">
			<Region from="1" to="154" loc="O"/>
			<Region from="155" to="170" loc="M"/>
			<Region from="171" to="275" loc="I"/>
			<Region from="276" to="291" loc="M"/>
			<Region from="292" to="315" loc="O"/>
		</Prediction>
		<Prediction name="Octopus">
			<Region from="1" to="8" loc="O"/>
			<Region from="9" to="29" loc="M"/>
			<Region from="30" to="47" loc="I"/>
			<Region from="48" to="68" loc="M"/>
			<Region from="69" to="315" loc="O"/>
		</Prediction>
		<Prediction name="Philius">
			<Region from="1" to="4" loc="O"/>
			<Region from="5" to="35" loc="M"/>
			<Region from="36" to="315" loc="I"/>
		</Prediction>
		<Prediction name="Phobius">
			<Region from="1" to="5" loc="O"/>
			<Region from="6" to="36" loc="M"/>
			<Region from="37" to="315" loc="I"/>
		</Prediction>
		<Prediction name="Pro">
			<Region from="1" to="4" loc="O"/>
			<Region from="5" to="25" loc="M"/>
			<Region from="26" to="315" loc="I"/>
		</Prediction>
		<Prediction name="Prodiv">
			<Region from="1" to="15" loc="O"/>
			<Region from="16" to="36" loc="M"/>
			<Region from="37" to="183" loc="I"/>
			<Region from="184" to="204" loc="M"/>
			<Region from="205" to="315" loc="O"/>
		</Prediction>
		<Prediction name="Scampi">
			<Region from="1" to="2" loc="I"/>
			<Region from="3" to="23" loc="M"/>
			<Region from="24" to="152" loc="O"/>
			<Region from="153" to="173" loc="M"/>
			<Region from="174" to="315" loc="I"/>
		</Prediction>
		<Prediction name="ScampiMsa">
			<Region from="1" to="15" loc="O"/>
			<Region from="16" to="35" loc="M"/>
			<Region from="36" to="315" loc="I"/>
		</Prediction>
		<Prediction name="TMHMM">
			<Region from="1" to="12" loc="I"/>
			<Region from="13" to="35" loc="M"/>
			<Region from="36" to="315" loc="O"/>
		</Prediction>
	</Predictions>
</CCTOPItem>
