<?xml version="1.0"?>
<CCTOPItem id="Q6AXJ3" transmembrane="yes" evidence="Prediction">
	<Copyright>Copyrighted by the Institute of Enzymology!</Copyright>
	<Name>Dexamethasone-induced protein homolog</Name>
	<CrossRef>
		<UniProt id="DEXI_DANRE">
			<AC>Q6AXJ3</AC>
		</UniProt>
	</CrossRef>
	<Sequence length="89" checkSum="bacdd6f35a6b5f820d238ef7d83ba2af">
		<Seq>MTNSVYFQLDSVESLIDELPYMYYLGLFFVNVLILYYAFLMEYIVLNVGI
VFLPEDMDQALVDLGVLSDPASIPYDTDTELDVFEGYLE</Seq>
	</Sequence>
	<Topology numTM="1" reliability="68.8344">
		<Region from="1" to="21" loc="I"/>
		<Region from="22" to="41" loc="M"/>
		<Region from="42" to="89" loc="O"/>
	</Topology>
	<Predictions>
		<Prediction name="HMMTOP">
			<Region from="1" to="24" loc="O"/>
			<Region from="25" to="52" loc="M"/>
			<Region from="53" to="89" loc="I"/>
		</Prediction>
		<Prediction name="Memsat">
			<Region from="1" to="21" loc="I"/>
			<Region from="22" to="52" loc="M"/>
			<Region from="53" to="89" loc="O"/>
		</Prediction>
		<Prediction name="Octopus">
			<Region from="1" to="23" loc="I"/>
			<Region from="24" to="44" loc="M"/>
			<Region from="45" to="89" loc="O"/>
		</Prediction>
		<Prediction name="Philius">
			<Region from="1" to="20" loc="I"/>
			<Region from="21" to="41" loc="M"/>
			<Region from="42" to="89" loc="O"/>
		</Prediction>
		<Prediction name="Phobius">
			<Region from="1" to="20" loc="O"/>
			<Region from="21" to="40" loc="M"/>
			<Region from="41" to="89" loc="I"/>
		</Prediction>
		<Prediction name="Pro">
			<Region from="1" to="20" loc="I"/>
			<Region from="21" to="41" loc="M"/>
			<Region from="42" to="89" loc="O"/>
		</Prediction>
		<Prediction name="Prodiv">
			<Region from="1" to="20" loc="I"/>
			<Region from="21" to="41" loc="M"/>
			<Region from="42" to="89" loc="O"/>
		</Prediction>
		<Prediction name="Scampi">
			<Region from="1" to="20" loc="I"/>
			<Region from="21" to="41" loc="M"/>
			<Region from="42" to="89" loc="O"/>
		</Prediction>
		<Prediction name="ScampiMsa">
			<Region from="1" to="20" loc="I"/>
			<Region from="21" to="40" loc="M"/>
			<Region from="41" to="89" loc="O"/>
		</Prediction>
		<Prediction name="TMHMM">
			<Region from="1" to="19" loc="O"/>
			<Region from="20" to="39" loc="M"/>
			<Region from="40" to="89" loc="I"/>
		</Prediction>
	</Predictions>
</CCTOPItem>
