<?xml version="1.0"?>
<CCTOPItem id="A0A044QK32" transmembrane="yes" evidence="Prediction">
	<Copyright>Copyrighted by the Institute of Enzymology!</Copyright>
	<Sequence length="78" checkSum="bdf6275be296759fbe211e0f8ec351c3">
		<Seq>MDAVSQPLEILDFDRHFRRRECHQLSEAIVNKINRDDLVCITWNFIAMVA
PFTILTALCIVIIATAIIYRNVRCRERT</Seq>
	</Sequence>
	<Topology numTM="1" reliability="83.8916">
		<Region from="1" to="45" loc="O"/>
		<Region from="46" to="68" loc="M"/>
		<Region from="69" to="78" loc="I"/>
	</Topology>
	<Predictions>
		<Prediction name="HMMTOP">
			<Region from="1" to="44" loc="O"/>
			<Region from="45" to="68" loc="M"/>
			<Region from="69" to="78" loc="I"/>
		</Prediction>
		<Prediction name="Memsat">
			<Region from="1" to="38" loc="I"/>
			<Region from="39" to="69" loc="M"/>
			<Region from="70" to="78" loc="O"/>
		</Prediction>
		<Prediction name="Octopus">
			<Region from="1" to="39" loc="I"/>
			<Region from="40" to="54" loc="M"/>
			<Region from="55" to="55" loc="O"/>
			<Region from="56" to="70" loc="M"/>
			<Region from="71" to="78" loc="I"/>
		</Prediction>
		<Prediction name="Philius">
			<Region from="1" to="46" loc="O"/>
			<Region from="47" to="69" loc="M"/>
			<Region from="70" to="78" loc="I"/>
		</Prediction>
		<Prediction name="Phobius">
			<Region from="1" to="44" loc="O"/>
			<Region from="45" to="69" loc="M"/>
			<Region from="70" to="78" loc="I"/>
		</Prediction>
		<Prediction name="Pro">
			<Region from="1" to="47" loc="O"/>
			<Region from="48" to="68" loc="M"/>
			<Region from="69" to="78" loc="I"/>
		</Prediction>
		<Prediction name="Prodiv">
			<Region from="1" to="45" loc="O"/>
			<Region from="46" to="68" loc="M"/>
			<Region from="69" to="78" loc="I"/>
		</Prediction>
		<Prediction name="Scampi">
			<Region from="1" to="48" loc="O"/>
			<Region from="49" to="69" loc="M"/>
			<Region from="70" to="78" loc="I"/>
		</Prediction>
		<Prediction name="ScampiMsa">
			<Region from="1" to="48" loc="O"/>
			<Region from="49" to="68" loc="M"/>
			<Region from="69" to="78" loc="I"/>
		</Prediction>
		<Prediction name="TMHMM">
			<Region from="1" to="45" loc="O"/>
			<Region from="46" to="68" loc="M"/>
			<Region from="69" to="78" loc="I"/>
		</Prediction>
	</Predictions>
</CCTOPItem>
