<?xml version="1.0"?>
<CCTOPItem id="B1WBR6" transmembrane="yes" evidence="Prediction">
	<Copyright>Copyrighted by the Institute of Enzymology!</Copyright>
	<Sequence length="362" checkSum="c1dd15a6b62ea249b7a40910631186fb">
		<Seq>MDSPEVTFTLAYLVFAVCFVFTPNEFYSAGLTVQNLLSGWLGSEDAAFVP
YHLRRTSATLLCHSLLPLGYYMGMCFAASEKQLYSPGQAPEAWQLFLLLA
VTLPLVSCTLIYYWSWDRWARHPLAQTLALYALPQSGWQAVASSINTEFR
RIDKFATGAPGARVIVTDTWVMKVTTYRVHVAQQQDVHLTVTESRQHDLS
PDSNLPVQLLTIHVASTSPGAQPFDIRLNSSEYGELCEKLRAPIRSAANV
VIRQSLGDLFLETFASLVEVNPAYSAPSNQELEACIGCMQTRASVKLVKT
CQEPAVGECQQCYCRPMWCLTCMGKWFASRQDPQRPDTWLASRVPCPTCR
ARFCILDVCCVR</Seq>
	</Sequence>
	<Topology numTM="3" reliability="74.9925">
		<Region from="1" to="5" loc="O"/>
		<Region from="6" to="26" loc="M"/>
		<Region from="27" to="57" loc="I"/>
		<Region from="58" to="78" loc="M"/>
		<Region from="79" to="94" loc="O"/>
		<Region from="95" to="115" loc="M"/>
		<Region from="116" to="362" loc="I"/>
	</Topology>
	<Predictions>
		<Prediction name="HMMTOP">
			<Region from="1" to="5" loc="O"/>
			<Region from="6" to="21" loc="M"/>
			<Region from="22" to="25" loc="I"/>
			<Region from="26" to="41" loc="M"/>
			<Region from="42" to="57" loc="O"/>
			<Region from="58" to="78" loc="M"/>
			<Region from="79" to="94" loc="I"/>
			<Region from="95" to="111" loc="M"/>
			<Region from="112" to="362" loc="O"/>
		</Prediction>
		<Prediction name="Memsat">
			<Region from="1" to="13" loc="O"/>
			<Region from="14" to="29" loc="M"/>
			<Region from="30" to="57" loc="I"/>
			<Region from="58" to="74" loc="M"/>
			<Region from="75" to="93" loc="O"/>
			<Region from="94" to="113" loc="M"/>
			<Region from="114" to="362" loc="I"/>
		</Prediction>
		<Prediction name="Octopus">
			<Region from="1" to="6" loc="O"/>
			<Region from="7" to="27" loc="M"/>
			<Region from="28" to="56" loc="I"/>
			<Region from="57" to="77" loc="M"/>
			<Region from="78" to="92" loc="O"/>
			<Region from="93" to="113" loc="M"/>
			<Region from="114" to="362" loc="I"/>
		</Prediction>
		<Prediction name="Philius">
			<Region from="1" to="7" loc="I"/>
			<Region from="8" to="31" loc="M"/>
			<Region from="32" to="92" loc="O"/>
			<Region from="93" to="116" loc="M"/>
			<Region from="117" to="362" loc="I"/>
		</Prediction>
		<Prediction name="Phobius">
			<Region from="1" to="5" loc="O"/>
			<Region from="6" to="27" loc="M"/>
			<Region from="28" to="59" loc="I"/>
			<Region from="60" to="80" loc="M"/>
			<Region from="81" to="91" loc="O"/>
			<Region from="92" to="114" loc="M"/>
			<Region from="115" to="362" loc="I"/>
		</Prediction>
		<Prediction name="Pro">
			<Region from="1" to="5" loc="I"/>
			<Region from="6" to="26" loc="M"/>
			<Region from="27" to="28" loc="O"/>
			<Region from="29" to="49" loc="M"/>
			<Region from="50" to="58" loc="I"/>
			<Region from="59" to="79" loc="M"/>
			<Region from="80" to="94" loc="O"/>
			<Region from="95" to="115" loc="M"/>
			<Region from="116" to="362" loc="I"/>
		</Prediction>
		<Prediction name="Prodiv">
			<Region from="1" to="5" loc="I"/>
			<Region from="6" to="26" loc="M"/>
			<Region from="27" to="28" loc="O"/>
			<Region from="29" to="49" loc="M"/>
			<Region from="50" to="58" loc="I"/>
			<Region from="59" to="79" loc="M"/>
			<Region from="80" to="94" loc="O"/>
			<Region from="95" to="115" loc="M"/>
			<Region from="116" to="362" loc="I"/>
		</Prediction>
		<Prediction name="Scampi">
			<Region from="1" to="6" loc="I"/>
			<Region from="7" to="27" loc="M"/>
			<Region from="28" to="52" loc="O"/>
			<Region from="53" to="73" loc="M"/>
			<Region from="74" to="94" loc="I"/>
			<Region from="95" to="115" loc="M"/>
			<Region from="116" to="362" loc="O"/>
		</Prediction>
		<Prediction name="ScampiMsa">
			<Region from="1" to="5" loc="O"/>
			<Region from="6" to="25" loc="M"/>
			<Region from="26" to="57" loc="I"/>
			<Region from="58" to="77" loc="M"/>
			<Region from="78" to="93" loc="O"/>
			<Region from="94" to="113" loc="M"/>
			<Region from="114" to="362" loc="I"/>
		</Prediction>
		<Prediction name="TMHMM">
			<Region from="1" to="6" loc="I"/>
			<Region from="7" to="29" loc="M"/>
			<Region from="30" to="56" loc="O"/>
			<Region from="57" to="79" loc="M"/>
			<Region from="80" to="91" loc="I"/>
			<Region from="92" to="114" loc="M"/>
			<Region from="115" to="362" loc="O"/>
		</Prediction>
	</Predictions>
</CCTOPItem>
