<?xml version="1.0"?>
<CCTOPItem id="A0A0U5KI45" transmembrane="yes" evidence="Prediction">
	<Copyright>Copyrighted by the Institute of Enzymology!</Copyright>
	<Sequence length="58" checkSum="c22fb4302875d2b80efd3833ff9cf7b1">
		<Seq>MQVDKFIIYTIVIIAIAIFVSMPEIHAFGIKFFTTTPVPNKGLLDKLLDG
LYQFFNRH</Seq>
	</Sequence>
	<Topology numTM="1" reliability="80.2648">
		<Region from="1" to="6" loc="I"/>
		<Region from="7" to="25" loc="M"/>
		<Region from="26" to="58" loc="O"/>
	</Topology>
	<Predictions>
		<Prediction name="HMMTOP">
			<Region from="1" to="5" loc="I"/>
			<Region from="6" to="21" loc="M"/>
			<Region from="22" to="58" loc="O"/>
		</Prediction>
		<Prediction name="Memsat">
			<Region from="1" to="12" loc="O"/>
			<Region from="13" to="28" loc="M"/>
			<Region from="29" to="58" loc="I"/>
		</Prediction>
		<Prediction name="Octopus">
			<Region from="1" to="6" loc="I"/>
			<Region from="7" to="27" loc="M"/>
			<Region from="28" to="58" loc="O"/>
		</Prediction>
		<Prediction name="Philius">
			<Region from="1" to="6" loc="I"/>
			<Region from="7" to="28" loc="M"/>
			<Region from="29" to="58" loc="O"/>
		</Prediction>
		<Prediction name="Phobius">
			<Region from="1" to="5" loc="O"/>
			<Region from="6" to="22" loc="M"/>
			<Region from="23" to="58" loc="I"/>
		</Prediction>
		<Prediction name="Pro">
			<Region from="1" to="6" loc="I"/>
			<Region from="7" to="27" loc="M"/>
			<Region from="28" to="58" loc="O"/>
		</Prediction>
		<Prediction name="Prodiv">
			<Region from="1" to="6" loc="I"/>
			<Region from="7" to="27" loc="M"/>
			<Region from="28" to="58" loc="O"/>
		</Prediction>
		<Prediction name="Scampi">
			<Region from="1" to="5" loc="I"/>
			<Region from="6" to="26" loc="M"/>
			<Region from="27" to="58" loc="O"/>
		</Prediction>
		<Prediction name="ScampiMsa">
			<Region from="1" to="5" loc="I"/>
			<Region from="6" to="25" loc="M"/>
			<Region from="26" to="58" loc="O"/>
		</Prediction>
		<Prediction name="TMHMM">
			<Region from="1" to="6" loc="I"/>
			<Region from="7" to="29" loc="M"/>
			<Region from="30" to="58" loc="O"/>
		</Prediction>
	</Predictions>
</CCTOPItem>
