<?xml version="1.0"?>
<CCTOPItem id="A0A0N4U0E0" transmembrane="yes" evidence="Prediction">
	<Copyright>Copyrighted by the Institute of Enzymology!</Copyright>
	<Sequence length="141" checkSum="c41713abbcf356d409bb1eca33b1e267">
		<Seq>MHELSKNIEEESKNFKASVLRITERTLKGAGDEIEDFFGEVPNTVAEKVN
NGVGGLLTKADEGISWIFRNIIVPIISLFILIALIYLAVISGCCGFCCSS
CLALLCEPVRNRFKKTGNTVSNERFVIVCKSTDDSVPLTYV</Seq>
	</Sequence>
	<Topology numTM="2" reliability="76.1802">
		<Region from="1" to="65" loc="I"/>
		<Region from="66" to="84" loc="M"/>
		<Region from="85" to="86" loc="O"/>
		<Region from="87" to="105" loc="M"/>
		<Region from="106" to="141" loc="I"/>
	</Topology>
	<Predictions>
		<Prediction name="HMMTOP">
			<Region from="1" to="70" loc="I"/>
			<Region from="71" to="98" loc="M"/>
			<Region from="99" to="141" loc="O"/>
		</Prediction>
		<Prediction name="Memsat">
			<Region from="1" to="71" loc="O"/>
			<Region from="72" to="102" loc="M"/>
			<Region from="103" to="141" loc="I"/>
		</Prediction>
		<Prediction name="Octopus">
			<Region from="1" to="70" loc="I"/>
			<Region from="71" to="85" loc="M"/>
			<Region from="86" to="86" loc="O"/>
			<Region from="87" to="101" loc="M"/>
			<Region from="102" to="141" loc="I"/>
		</Prediction>
		<Prediction name="Philius">
			<Region from="1" to="65" loc="I"/>
			<Region from="66" to="85" loc="M"/>
			<Region from="86" to="86" loc="O"/>
			<Region from="87" to="106" loc="M"/>
			<Region from="107" to="141" loc="I"/>
		</Prediction>
		<Prediction name="Phobius">
			<Region from="1" to="74" loc="O"/>
			<Region from="75" to="105" loc="M"/>
			<Region from="106" to="141" loc="I"/>
		</Prediction>
		<Prediction name="Pro">
			<Region from="1" to="62" loc="I"/>
			<Region from="63" to="83" loc="M"/>
			<Region from="84" to="85" loc="O"/>
			<Region from="86" to="106" loc="M"/>
			<Region from="107" to="141" loc="I"/>
		</Prediction>
		<Prediction name="Prodiv">
			<Region from="1" to="62" loc="I"/>
			<Region from="63" to="83" loc="M"/>
			<Region from="84" to="85" loc="O"/>
			<Region from="86" to="106" loc="M"/>
			<Region from="107" to="141" loc="I"/>
		</Prediction>
		<Prediction name="Scampi">
			<Region from="1" to="63" loc="I"/>
			<Region from="64" to="84" loc="M"/>
			<Region from="85" to="85" loc="O"/>
			<Region from="86" to="106" loc="M"/>
			<Region from="107" to="141" loc="I"/>
		</Prediction>
		<Prediction name="ScampiMsa">
			<Region from="1" to="63" loc="I"/>
			<Region from="64" to="83" loc="M"/>
			<Region from="84" to="85" loc="O"/>
			<Region from="86" to="105" loc="M"/>
			<Region from="106" to="141" loc="I"/>
		</Prediction>
		<Prediction name="TMHMM">
			<Region from="1" to="70" loc="O"/>
			<Region from="71" to="105" loc="M"/>
			<Region from="106" to="141" loc="I"/>
		</Prediction>
	</Predictions>
</CCTOPItem>
